| UniProt ID | RSPO1_HUMAN | |
|---|---|---|
| UniProt AC | Q2MKA7 | |
| Protein Name | R-spondin-1 | |
| Gene Name | RSPO1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 263 | |
| Subcellular Localization | Secreted . Nucleus . Seems to mainly localize to nucleoli. | |
| Protein Description | Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. [PubMed: 17804805] | |
| Protein Sequence | MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 137 | N-linked_Glycosylation | PEGSSAANGTMECSS CCCCCCCCCCCEECC | 46.30 | UniProtKB CARBOHYD | |
| 253 | Phosphorylation | QQQQQQGTVGPLTSA HHHHHCCCCCCCCCC | 20.25 | 29978859 | |
| 258 | Phosphorylation | QGTVGPLTSAGPA-- CCCCCCCCCCCCC-- | 21.47 | 29978859 | |
| 259 | Phosphorylation | GTVGPLTSAGPA--- CCCCCCCCCCCC--- | 38.62 | 29978859 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSPO1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSPO1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSPO1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LGR4_HUMAN | LGR4 | physical | 24050775 | |
| LGR4_HUMAN | LGR4 | physical | 24165923 | |
| ZNRF3_HUMAN | ZNRF3 | physical | 24165923 | |
| LGR4_HUMAN | LGR4 | physical | 24225776 | |
| C1QBP_HUMAN | C1QBP | physical | 26186194 | |
| ZZEF1_HUMAN | ZZEF1 | physical | 26186194 | |
| SORL_HUMAN | SORL1 | physical | 26186194 | |
| HECD3_HUMAN | HECTD3 | physical | 26186194 | |
| CHTOP_HUMAN | CHTOP | physical | 26186194 | |
| LACRT_HUMAN | LACRT | physical | 26186194 | |
| LRP1B_HUMAN | LRP1B | physical | 26186194 | |
| ZN579_HUMAN | ZNF579 | physical | 26186194 | |
| CEP76_HUMAN | CEP76 | physical | 26186194 | |
| ZNRF3_HUMAN | ZNRF3 | physical | 24050775 | |
| RNF43_HUMAN | RNF43 | physical | 25825523 | |
| LACRT_HUMAN | LACRT | physical | 28514442 | |
| CHTOP_HUMAN | CHTOP | physical | 28514442 | |
| ZN579_HUMAN | ZNF579 | physical | 28514442 | |
| HECD3_HUMAN | HECTD3 | physical | 28514442 | |
| CEP76_HUMAN | CEP76 | physical | 28514442 | |
| C1QBP_HUMAN | C1QBP | physical | 28514442 | |
| ZZEF1_HUMAN | ZZEF1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
