| UniProt ID | PRX_SCHPO | |
|---|---|---|
| UniProt AC | O94561 | |
| Protein Name | Peroxiredoxin bcp1 | |
| Gene Name | bcp1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 195 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events (By similarity). Acts as a scavenger of H(2)O(2). [PubMed: 20356456] | |
| Protein Sequence | MDAPRRSSRLAAKIANVLDSKGTIIPEAAPVMLKKPAKDESVDSTIQVGDVIPDITLPDEDGTSIRLRDITANKGLVIFAYPKASTPGCTKQGCGFRDNYPKIQASDYEVLGLSFDTSKAQKAFKDKQNFPYHLLSDPKGELIKKLGAEKPGGGKLFRSHWIFEKGTGKCIVKEIDISPLVSVDKAFAVITDSEP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PRX_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRX_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRX_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRX_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SPT3_SCHPO | spt3 | genetic | 19547744 | |
| YBH4_SCHPO | SPBC3B8.04c | genetic | 22681890 | |
| PVG2_SCHPO | pvg2 | genetic | 22681890 | |
| RYH1_SCHPO | ryh1 | genetic | 22681890 | |
| YEG3_SCHPO | pcf2 | genetic | 22681890 | |
| UCP6_SCHPO | ucp6 | genetic | 22681890 | |
| YAKB_SCHPO | SPAC1F7.11c | genetic | 22681890 | |
| TIM21_SCHPO | tim21 | genetic | 22681890 | |
| YBPC_SCHPO | SPBC16H5.12c | genetic | 22681890 | |
| AROG_SCHPO | SPAP8A3.07c | genetic | 22681890 | |
| ELP1_SCHPO | elp1 | genetic | 22681890 | |
| ERFD_SCHPO | erf4 | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
