dbPTM

TIM21_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TIM21_SCHPO
UniProt AC	O94618
Protein Name	Mitochondrial import inner membrane translocase subunit tim21
Gene Name	tim21
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	223
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein.
Protein Description	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to keep the TOM and the TIM23 complexes in close contact. At some point, it is released from the TOM23 complex to allow protein translocation into the mitochondrial matrix (By similarity)..
Protein Sequence	MIRTIQRQSATRFSSALVQRRLYSLASDSLNKQRKPQEEGRLARIFKDPSNKAWKDLTAPQKAYRTSANIGNFSIVIFGGGVFGLIIYALVTSIWKGEAHYGDEAFELLKANEECRYVFGDHMKALGEATHPLRRTHGILTSRVWDHHGVEHLVLQFHLIGNERKGHVFGRLVNVQGDYKWEYLFVDVANYGKIIIFDHTNSVRQQHKNFGLWGSLKNITWGN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TIM21_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TIM21_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TIM21_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TIM21_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TIM21_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TIM21_SCHPO

Related Literatures of Post-Translational Modification