| UniProt ID | PGL1A_ARATH | |
|---|---|---|
| UniProt AC | Q8H112 | |
| Protein Name | PGR5-like protein 1A, chloroplastic | |
| Gene Name | PGRL1A | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 324 | |
| Subcellular Localization |
Plastid, chloroplast thylakoid membrane Multi-pass membrane protein . Predominantly located in the appressed regions of the thylakoids and less abundant in the stroma lamellae. |
|
| Protein Description | Ferredoxin-plastoquinone reductase involved in cyclic electron flow (CEF) around photosystem I. The homodimer is probably not involved in CEF.. | |
| Protein Sequence | MGSKMLFSLTSPRLFSAVSRKPSSSFSPSPPSPSSRTQWTQLSPGKSISLRRRVFLLPAKATTEQSGPVGGDNVDSNVLPYCSINKAEKKTIGEMEQEFLQALQSFYYDGKAIMSNEEFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDGSDIVSEGPRCSLRSKKVYSDLAVDYFKMLLLNVPATVVALGLFFFLDDITGFEITYIMELPEPYSFIFTWFAAVPVIVYLALSITKLIIKDFLILKGPCPNCGTENTSFFGTILSISSGGKTNTVKCTNCGTAMVYDSGSRLITLPEGSQA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | Acetylation | VFLLPAKATTEQSGP EEEEECCCCCCCCCC | 23.12 | - | |
| 62 | Phosphorylation | FLLPAKATTEQSGPV EEEECCCCCCCCCCC | 30.11 | 27545962 | |
| 63 | Phosphorylation | LLPAKATTEQSGPVG EEECCCCCCCCCCCC | 36.57 | 19376835 | |
| 66 | Phosphorylation | AKATTEQSGPVGGDN CCCCCCCCCCCCCCC | 38.54 | 19376835 | |
| 76 | Phosphorylation | VGGDNVDSNVLPYCS CCCCCCCCCCCCCCC | 25.26 | 19376835 | |
| 81 | Phosphorylation | VDSNVLPYCSINKAE CCCCCCCCCCCCHHH | 8.48 | 19376835 | |
| 83 | Phosphorylation | SNVLPYCSINKAEKK CCCCCCCCCCHHHCC | 24.29 | 19376835 | |
| 322 | Phosphorylation | LITLPEGSQA----- EEECCCCCCC----- | 22.67 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGL1A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGL1A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGL1A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FNRL2_ARATH | FNR2 | physical | 18243102 | |
| PGR5_ARATH | PGR5 | physical | 18243102 | |
| FNRL1_ARATH | FNR1 | physical | 18243102 | |
| FER2_ARATH | FED A | physical | 18243102 | |
| PSAD1_ARATH | PSAD-1 | physical | 18243102 | |
| CYB6_ARATH | petB | physical | 18243102 | |
| HHP4_ARATH | HHP4 | physical | 24833385 | |
| UBC34_ARATH | UBC34 | physical | 24833385 | |
| CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
| SPCS1_ARATH | AT2G22425 | physical | 24833385 | |
| WAK3_ARATH | WAK3 | physical | 24833385 | |
| PAM74_ARATH | AT5G59650 | physical | 24833385 | |
| BETL2_ARATH | AT1G29060 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
