PGR5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PGR5_ARATH
• UniProt AC: Q9SL05
• Protein Name: Protein PROTON GRADIENT REGULATION 5, chloroplastic
• Gene Name: PGR5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 133
• Subcellular Localization: Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein ; Stromal side .
• Protein Description: Involved in the regulation of the cyclic electron flow (CEF) around Photosystem I. Essential for the reduction of PGRL1A by ferredoxin and for photoprotection..
• Protein Sequence: MAAASISAIGCNQTLIGTSFYGGWGSSISGEDYQTMLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNLVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PGR5_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PGR5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PGR5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PGR5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PGL1A_ARATH	PGR5-LIKE A	physical	18243102
PGL1B_ARATH	PGRL1B	physical	18243102
FER2_ARATH	FED A	physical	18243102

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.