UniProt ID | PGL1B_ARATH | |
---|---|---|
UniProt AC | Q8GYC7 | |
Protein Name | PGR5-like protein 1B, chloroplastic | |
Gene Name | PGRL1B | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 313 | |
Subcellular Localization |
Plastid, chloroplast thylakoid membrane Multi-pass membrane protein . |
|
Protein Description | Ferredoxin-plastoquinone reductase involved in cyclic electron flow (CEF) around photosystem I. The homodimer is probably not involved in CEF.. | |
Protein Sequence | MAFTLTIPRFSAISRKPITCSSSRTQCPAPFTHGRSISLRRRLTLLPLKASTDQSGQVGGEEVDSKILPYCSINKNEKRTIGEMEQEFLQAMQSFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIVCEGPRCSLRSKKVYSDLAIDYFKMFLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPAIVYLALSLTKLILKDFLILKGPCPNCGTENVSFFGTILSIPNDSNTNNVKCSGCGTEMVYDSGSRLITLPEGGKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Acetylation | LTLLPLKASTDQSGQ EEEEEECCCCCCCCC | 25.91 | 22223895 | |
51 | Phosphorylation | TLLPLKASTDQSGQV EEEEECCCCCCCCCC | 30.81 | 19880383 | |
52 | Phosphorylation | LLPLKASTDQSGQVG EEEECCCCCCCCCCC | 42.81 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGL1B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGL1B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGL1B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FNRL1_ARATH | FNR1 | physical | 18243102 | |
FER2_ARATH | FED A | physical | 18243102 | |
PSAD1_ARATH | PSAD-1 | physical | 18243102 | |
FNRL2_ARATH | FNR2 | physical | 18243102 | |
PGR5_ARATH | PGR5 | physical | 18243102 | |
ROGF4_ARATH | ROPGEF4 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...