CYB6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYB6_ARATH
• UniProt AC: P56773
• Protein Name: Cytochrome b6 {ECO:0000255|HAMAP-Rule:MF_00633}
• Gene Name: petB {ECO:0000255|HAMAP-Rule:MF_00633}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 215
• Subcellular Localization: Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein .
• Protein Description: Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions..
• Protein Sequence: MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSKVYDWFE ------CCCHHHHHH	30.72	30291188
5	Nitration	---MSKVYDWFEERL ---CCCHHHHHHHHH	15.93	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CYB6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYB6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYB6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PGR5_ARATH	PGR5	physical	18243102

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.