NFYC9_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYC9_ARATH
• UniProt AC: Q8L4B2
• Protein Name: Nuclear transcription factor Y subunit C-9
• Gene Name: NFYC9
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 231
• Subcellular Localization: Nucleus.
• Protein Description: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways. [PubMed: 25105952]
• Protein Sequence: MDQQDHGQSGAMNYGTNPYQTNPMSTTAATVAGGAAQPGQLAFHQIHQQQQQQQLAQQLQAFWENQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVLGSIPRGTVPEAAAAGYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQPDQEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
168	Phosphorylation	LRDEVLGSIPRGTVP HCHHHHCCCCCCCHH	25.84	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYC9_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYC9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYC9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYBA_ARATH	NF-YB10	physical	22199235
NFYB3_ARATH	NF-YB3	physical	22199235
NFYB1_ARATH	NF-YB1	physical	22199235
NFYB2_ARATH	NF-YB2	physical	22199235
NFYB4_ARATH	NF-YB4	physical	22199235
NFYB5_ARATH	NF-YB5	physical	22199235
NFYB6_ARATH	NF-YB6	physical	22199235
NFYB7_ARATH	NF-YB7	physical	22199235
NFYB8_ARATH	NF-YB8	physical	22199235
NFYB9_ARATH	LEC1	physical	22199235
NFYA1_ARATH	NF-YA1	physical	22199235
NFYA2_ARATH	NF-YA2	physical	22199235
NFYA3_ARATH	NF-YA3	physical	22199235
NFYA4_ARATH	NF-YA4	physical	22199235
NFYA7_ARATH	NF-YA7	physical	22199235
NFYB1_ARATH	NF-YB1	physical	22912760
NFYB2_ARATH	NF-YB2	physical	22912760
NFYB3_ARATH	NF-YB3	physical	22912760
NFYB4_ARATH	NF-YB4	physical	22912760
NFYB5_ARATH	NF-YB5	physical	22912760
NFYB6_ARATH	NF-YB6	physical	22912760
NFYB7_ARATH	NF-YB7	physical	22912760
NFYB8_ARATH	NF-YB8	physical	22912760
NFYBA_ARATH	NF-YB10	physical	22912760
GAI_ARATH	GAI	physical	25105952
RGL1_ARATH	RGL1	physical	25105952
RGL2_ARATH	RGL2	physical	25105952

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.