NFYA3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYA3_ARATH
• UniProt AC: Q93ZH2
• Protein Name: Nuclear transcription factor Y subunit A-3
• Gene Name: NFYA3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 340
• Subcellular Localization: Nucleus .
• Protein Description: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
• Protein Sequence: MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Phosphorylation	RGSAESLSLKVDSRP CCCCCCEEEEECCCC	35.11	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYA3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYA3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYA3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYB3_ARATH	NF-YB3	physical	21798944
NFYC1_ARATH	NF-YC1	physical	22199235
NFYC4_ARATH	NF-YC4	physical	22199235

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.