dbPTM

NFYC1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NFYC1_ARATH
UniProt AC	Q9SMP0
Protein Name	Nuclear transcription factor Y subunit C-1
Gene Name	NFYC1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	234
Subcellular Localization	Nucleus.
Protein Description	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
Protein Sequence	MDTNNQQPPPSAAGIPPPPPGTTISAAGGGASYHHLLQQQQQQLQLFWTYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDEAAVLGGGMVVAPTASGVPYYYPPMGQPAGPGGMMIGRPAMDPNGVYVQPPSQAWQSVWQTSTGTGDDVSYGSGGSSGQGNLDGQG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of NFYC1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NFYC1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NFYC1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NFYC1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYB1_ARATH	NF-YB1	physical	22199235
NFYB4_ARATH	NF-YB4	physical	22199235
NFYB5_ARATH	NF-YB5	physical	22199235
NFYB6_ARATH	NF-YB6	physical	22199235
NFYB7_ARATH	NF-YB7	physical	22199235
NFYB8_ARATH	NF-YB8	physical	22199235
NFYB9_ARATH	LEC1	physical	22199235
NFYBA_ARATH	NF-YB10	physical	22199235
NFYA1_ARATH	NF-YA1	physical	22199235
NFYA2_ARATH	NF-YA2	physical	22199235
NFYA3_ARATH	NF-YA3	physical	22199235
NFYA4_ARATH	NF-YA4	physical	22199235
NFYA7_ARATH	NF-YA7	physical	22199235
NFYA8_ARATH	NF-YA8	physical	22199235
NFYA9_ARATH	NF-YA9	physical	22199235
NFYAA_ARATH	NF-YA10	physical	22199235
NFYB1_ARATH	NF-YB1	physical	22912760
NFYB2_ARATH	NF-YB2	physical	22912760
NFYB3_ARATH	NF-YB3	physical	22912760
NFYB4_ARATH	NF-YB4	physical	22912760
NFYB5_ARATH	NF-YB5	physical	22912760
NFYB6_ARATH	NF-YB6	physical	22912760
NFYB7_ARATH	NF-YB7	physical	22912760
NFYB8_ARATH	NF-YB8	physical	22912760
NFYBA_ARATH	NF-YB10	physical	22912760

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NFYC1_ARATH

Related Literatures of Post-Translational Modification