NFYA4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYA4_ARATH
• UniProt AC: Q8VY64
• Protein Name: Nuclear transcription factor Y subunit A-4
• Gene Name: NFYA4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 198
• Subcellular Localization: Nucleus .
• Protein Description: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
• Protein Sequence: MTSSVHELSDNNESHAKKERPDSQTRPQVPSGRSSESIDTNSVYSEPMAHGLYPYPDPYYRSVFAQQAYLPHPYPGVQLQLMGMQQPGVPLQCDAVEEPVFVNAKQYHGILRRRQSRAKLEARNRAIKAKKPYMHESRHLHAIRRPRGCGGRFLNAKKENGDHKEEEEATSDENTSEASSSLRSEKLAMATSGPNGRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTSSVHELS ------CCCCCCCCC	29.70	25561503
3	Phosphorylation	-----MTSSVHELSD -----CCCCCCCCCC	29.12	25561503
4	Phosphorylation	----MTSSVHELSDN ----CCCCCCCCCCC	20.51	25561503
9	Phosphorylation	TSSVHELSDNNESHA CCCCCCCCCCCHHHC	34.99	30407730
14	Phosphorylation	ELSDNNESHAKKERP CCCCCCHHHCCHHCC	30.76	25561503
23	Phosphorylation	AKKERPDSQTRPQVP CCHHCCCCCCCCCCC	35.81	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYA4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYA4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYA4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BOI_ARATH	RING	physical	21798944
CLAH2_ARATH	AT3G08530	physical	21798944
NFYB3_ARATH	NF-YB3	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.