NFYAA_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYAA_ARATH
• UniProt AC: Q8LFU0
• Protein Name: Nuclear transcription factor Y subunit A-10
• Gene Name: NFYA10
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 269
• Subcellular Localization: Nucleus .
• Protein Description: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
• Protein Sequence: MQTEELLSPPQTPWWNAFGSQPLTTESLSGEASDSFTGVKAVTTEAEQGVVDKQTSTTLFTFSPGGEKSSRDVPKPHVAFAMQSACFEFGFAQPMMYTKHPHVEQYYGVVSAYGSQRSSGRVMIPLKMETEEDGTIYVNSKQYHGIIRRRQSRAKAEKLSRCRKPYMHHSRHLHAMRRPRGSGGRFLNTKTADAAKQSKPSNSQSSEVFHPENETINSSREANESNLSDSAVTSMDYFLSSSAYSPGGMVMPIKWNAAAMDIGCCKLNI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
56	Phosphorylation	GVVDKQTSTTLFTFS CCCCCCCCEEEEEEC	19.53	19880383
57	Phosphorylation	VVDKQTSTTLFTFSP CCCCCCCEEEEEECC	30.79	19880383
58	Phosphorylation	VDKQTSTTLFTFSPG CCCCCCEEEEEECCC	21.46	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYAA_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYAA_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYAA_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of NFYAA_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.