NFYBA_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYBA_ARATH
• UniProt AC: Q67XJ2
• Protein Name: Nuclear transcription factor Y subunit B-10
• Gene Name: NFYB10
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 176
• Subcellular Localization: Nucleus .
• Protein Description: Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
• Protein Sequence: MAESQTGGGGGGSHESGGDQSPRSLNVREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLMRYREMEGDTKGSGKGGESSAKRDGQPSQVSQFSQVPQQGSFSQGPYGNSQGSNMMVQMPGTE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAESQTGGG ------CCCCCCCCC	25.75	-
6	Phosphorylation	--MAESQTGGGGGGS --CCCCCCCCCCCCC	47.26	25561503
13	Phosphorylation	TGGGGGGSHESGGDQ CCCCCCCCCCCCCCC	27.62	25561503
16	Phosphorylation	GGGGSHESGGDQSPR CCCCCCCCCCCCCCC	42.52	25561503
21	Phosphorylation	HESGGDQSPRSLNVR CCCCCCCCCCCCCHH	27.33	27545962

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYBA_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYBA_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYBA_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYC1_ARATH	NF-YC1	physical	22199235
NFYC2_ARATH	NF-YC2	physical	22199235
NFYC3_ARATH	NF-YC3	physical	22199235
NFYC4_ARATH	NF-YC4	physical	22199235
NFYC7_ARATH	NF-YC7	physical	22199235
NFYC6_ARATH	NF-YC6	physical	22199235
NFYCA_ARATH	NF-YC12	physical	22199235
NFYC8_ARATH	NF-YC8	physical	22199235
NFYC9_ARATH	NF-YC9	physical	22199235
NFYC1_ARATH	NF-YC1	physical	22912760
NFYC2_ARATH	NF-YC2	physical	22912760
NFYC3_ARATH	NF-YC3	physical	22912760
NFYC4_ARATH	NF-YC4	physical	22912760
NFYC5_ARATH	NF-YC5	physical	22912760
NFYC6_ARATH	NF-YC6	physical	22912760
NFYC7_ARATH	NF-YC7	physical	22912760
NFYC8_ARATH	NF-YC8	physical	22912760
NFYC9_ARATH	NF-YC9	physical	22912760

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.