UniProt ID | NFYCA_ARATH | |
---|---|---|
UniProt AC | Q58CM8 | |
Protein Name | Nuclear transcription factor Y subunit C-10 | |
Gene Name | NFYC10 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 195 | |
Subcellular Localization | Nucleus. | |
Protein Description | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.. | |
Protein Sequence | MRRPKSSHVRMEPVAPRSHNTMPMLDQFRSNHPETSKIEGVSSLDTALKVFWNNQREQLGNFAGQTHLPLSRVRKILKSDPEVKKISCDVPALFSKACEYFILEVTLRAWMHTQSCTRETIRRCDIFQAVKNSGTYDFLIDRVPFGPHCVTHQGVQPPAEMILPDMNVPIDMDQIEEENMMEERSVGFDLNCDLQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of NFYCA_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFYCA_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NFYCA_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFYCA_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NFYB1_ARATH | NF-YB1 | physical | 22199235 | |
NFYB2_ARATH | NF-YB2 | physical | 22199235 | |
NFYB3_ARATH | NF-YB3 | physical | 22199235 | |
NFYB4_ARATH | NF-YB4 | physical | 22199235 | |
NFYB5_ARATH | NF-YB5 | physical | 22199235 | |
NFYB6_ARATH | NF-YB6 | physical | 22199235 | |
NFYB7_ARATH | NF-YB7 | physical | 22199235 | |
NFYB8_ARATH | NF-YB8 | physical | 22199235 | |
NFYB9_ARATH | LEC1 | physical | 22199235 | |
NFYBA_ARATH | NF-YB10 | physical | 22199235 | |
NFYA1_ARATH | NF-YA1 | physical | 22199235 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...