NFYCA_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYCA_ARATH
• UniProt AC: Q58CM8
• Protein Name: Nuclear transcription factor Y subunit C-10
• Gene Name: NFYC10
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 195
• Subcellular Localization: Nucleus.
• Protein Description: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
• Protein Sequence: MRRPKSSHVRMEPVAPRSHNTMPMLDQFRSNHPETSKIEGVSSLDTALKVFWNNQREQLGNFAGQTHLPLSRVRKILKSDPEVKKISCDVPALFSKACEYFILEVTLRAWMHTQSCTRETIRRCDIFQAVKNSGTYDFLIDRVPFGPHCVTHQGVQPPAEMILPDMNVPIDMDQIEEENMMEERSVGFDLNCDLQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of NFYCA_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYCA_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYCA_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYCA_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYB1_ARATH	NF-YB1	physical	22199235
NFYB2_ARATH	NF-YB2	physical	22199235
NFYB3_ARATH	NF-YB3	physical	22199235
NFYB4_ARATH	NF-YB4	physical	22199235
NFYB5_ARATH	NF-YB5	physical	22199235
NFYB6_ARATH	NF-YB6	physical	22199235
NFYB7_ARATH	NF-YB7	physical	22199235
NFYB8_ARATH	NF-YB8	physical	22199235
NFYB9_ARATH	LEC1	physical	22199235
NFYBA_ARATH	NF-YB10	physical	22199235
NFYA1_ARATH	NF-YA1	physical	22199235

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.