| UniProt ID | NFYB5_ARATH | |
|---|---|---|
| UniProt AC | O82248 | |
| Protein Name | Nuclear transcription factor Y subunit B-5 | |
| Gene Name | NFYB5 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 160 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.. | |
| Protein Sequence | MAGNYHSFQNPIPRYQNYNFGSSSSNHQHEHDGLVVVVEDQQQEESMMVKEQDRLLPIANVGRIMKNILPANAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAAQLKKYLHRYRVLEGEKPNHHGKGGPKSSPDN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of NFYB5_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFYB5_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NFYB5_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFYB5_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NFYC4_ARATH | NF-YC4 | physical | 22199235 | |
| NFYC3_ARATH | NF-YC3 | physical | 22199235 | |
| NFYC2_ARATH | NF-YC2 | physical | 22199235 | |
| NFYC7_ARATH | NF-YC7 | physical | 22199235 | |
| NFYC9_ARATH | NF-YC9 | physical | 22199235 | |
| NFYC1_ARATH | NF-YC1 | physical | 22912760 | |
| NFYC2_ARATH | NF-YC2 | physical | 22912760 | |
| NFYC3_ARATH | NF-YC3 | physical | 22912760 | |
| NFYC4_ARATH | NF-YC4 | physical | 22912760 | |
| NFYC5_ARATH | NF-YC5 | physical | 22912760 | |
| NFYC6_ARATH | NF-YC6 | physical | 22912760 | |
| NFYC7_ARATH | NF-YC7 | physical | 22912760 | |
| NFYC8_ARATH | NF-YC8 | physical | 22912760 | |
| NFYC9_ARATH | NF-YC9 | physical | 22912760 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...