dbPTM

NFYB5_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NFYB5_ARATH
UniProt AC	O82248
Protein Name	Nuclear transcription factor Y subunit B-5
Gene Name	NFYB5
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	160
Subcellular Localization	Nucleus .
Protein Description	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
Protein Sequence	MAGNYHSFQNPIPRYQNYNFGSSSSNHQHEHDGLVVVVEDQQQEESMMVKEQDRLLPIANVGRIMKNILPANAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAAQLKKYLHRYRVLEGEKPNHHGKGGPKSSPDN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of NFYB5_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NFYB5_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NFYB5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NFYB5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYC4_ARATH	NF-YC4	physical	22199235
NFYC3_ARATH	NF-YC3	physical	22199235
NFYC2_ARATH	NF-YC2	physical	22199235
NFYC7_ARATH	NF-YC7	physical	22199235
NFYC9_ARATH	NF-YC9	physical	22199235
NFYC1_ARATH	NF-YC1	physical	22912760
NFYC2_ARATH	NF-YC2	physical	22912760
NFYC3_ARATH	NF-YC3	physical	22912760
NFYC4_ARATH	NF-YC4	physical	22912760
NFYC5_ARATH	NF-YC5	physical	22912760
NFYC6_ARATH	NF-YC6	physical	22912760
NFYC7_ARATH	NF-YC7	physical	22912760
NFYC8_ARATH	NF-YC8	physical	22912760
NFYC9_ARATH	NF-YC9	physical	22912760

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NFYB5_ARATH

Related Literatures of Post-Translational Modification