NFYA1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYA1_ARATH
• UniProt AC: Q9LXV5
• Protein Name: Nuclear transcription factor Y subunit A-1
• Gene Name: NFYA1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 272
• Subcellular Localization: Nucleus .
• Protein Description: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
• Protein Sequence: MQSKPGRENEEEVNNHHAVQQPMMYAEPWWKNNSFGVVPQARPSGIPSNSSSLDCPNGSESNDVHSASEDGALNGENDGTWKDSQAATSSRSVDNHGMEGNDPALSIRNMHDQPLVQPPELVGHYIACVPNPYQDPYYGGLMGAYGHQQLGFRPYLGMPRERTALPLDMAQEPVYVNAKQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGRFAKKSEVEAGEDAGGRDRERGSATNSSGSEQVETDSNETLNSSGAP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
92	Phosphorylation	QAATSSRSVDNHGME HHHCCCCCHHHCCCC	35.45	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYA1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYA1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYA1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYC3_ARATH	NF-YC3	physical	25105952
NFYC9_ARATH	NF-YC9	physical	25105952

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.