NFYA2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFYA2_ARATH
• UniProt AC: Q9M9X4
• Protein Name: Nuclear transcription factor Y subunit A-2
• Gene Name: NFYA2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 295
• Subcellular Localization: Nucleus .
• Protein Description: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters..
• Protein Sequence: MAMQTVREGLFSAPQTSWWTAFGSQPLAPESLAGDSDSFAGVKVGSVGETGQRVDKQSNSATHLAFSLGDVKSPRLVPKPHGATFSMQSPCLELGFSQPPIYTKYPYGEQQYYGVVSAYGSQSRVMLPLNMETEDSTIYVNSKQYHGIIRRRQSRAKAAAVLDQKKLSSRCRKPYMHHSRHLHALRRPRGSGGRFLNTKSQNLENSGTNAKKGDGSMQIQSQPKPQQSNSQNSEVVHPENGTMNLSNGLNVSGSEVTSMNYFLSSPVHSLGGMVMPSKWIAAAAAMDNGCCNFKT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of NFYA2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NFYA2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFYA2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFYA2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFYC3_ARATH	NF-YC3	physical	25105952
NFYC9_ARATH	NF-YC9	physical	25105952
GAI_ARATH	GAI	physical	25105952
RGL1_ARATH	RGL1	physical	25105952
RGL2_ARATH	RGL2	physical	25105952
NFYB3_ARATH	NF-YB3	physical	25490919
NRPB3_ARATH	NRPB3	physical	25490919

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.