UniProt ID | NEUFC_HUMAN | |
---|---|---|
UniProt AC | Q8WUJ1 | |
Protein Name | Neuferricin | |
Gene Name | CYB5D2 {ECO:0000312|HGNC:HGNC:28471} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 264 | |
Subcellular Localization | Secreted. | |
Protein Description | Heme-binding protein which promotes neuronal but not astrocyte differentiation.. | |
Protein Sequence | MLRCGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEANKLQLQEKQTFPPCNAEWSSARGSRLWCSQKSGGVSRDWIGVPRKLYKPGAKEPRCVCVRTTGPPSGQMPDNPPHRNRGDLDHPNLAEYTGCPPLAITCSFPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Ubiquitination | SRYRGGPGDPGLYLA HHHCCCCCCHHHHHH | 57.95 | 29967540 | |
163 | Ubiquitination | TRGLEANKLQLQEKQ HHCHHHHCCCCCCCC | 44.66 | 29967540 | |
208 | Phosphorylation | IGVPRKLYKPGAKEP CCCCHHHCCCCCCCC | 20.40 | - | |
227 | Phosphorylation | VRTTGPPSGQMPDNP EEECCCCCCCCCCCC | 44.80 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEUFC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEUFC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEUFC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NPTX2_HUMAN | NPTX2 | physical | 28514442 | |
ATRAP_HUMAN | AGTRAP | physical | 28514442 | |
PTX3_HUMAN | PTX3 | physical | 28514442 | |
ABLM1_HUMAN | ABLIM1 | physical | 28514442 | |
NPTXR_HUMAN | NPTXR | physical | 28514442 | |
GRAP1_HUMAN | GRIPAP1 | physical | 28514442 | |
ZNT5_HUMAN | SLC30A5 | physical | 28514442 | |
PDIP3_HUMAN | POLDIP3 | physical | 28514442 | |
KLH42_HUMAN | KLHL42 | physical | 28514442 | |
NPTX1_HUMAN | NPTX1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...