| UniProt ID | MTF2_MOUSE | |
|---|---|---|
| UniProt AC | Q02395 | |
| Protein Name | Metal-response element-binding transcription factor 2 | |
| Gene Name | Mtf2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 593 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter.. | |
| Protein Sequence | MRDSTGAGNSLVHKRSPLRRNQKTSASLNKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPTSDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAELPLDKESVSENPTLDLPCSIGRTEGIAHSSNTSDVDLTGASSANETTSASISRHCGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEVVKDDEGKEDYQFEELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Phosphorylation | PLRRNQKTSASLNKL CCCCCCCCCHHHHHC | 21.55 | - | |
| 25 | Phosphorylation | LRRNQKTSASLNKLS CCCCCCCCHHHHHCC | 23.93 | 20139300 | |
| 27 | Phosphorylation | RNQKTSASLNKLSLQ CCCCCCHHHHHCCCC | 32.04 | 20139300 | |
| 83 | Phosphorylation | CFIIFEDSSKSWVLW EEEEEECCCCCEEEE | 32.25 | 29899451 | |
| 84 | Phosphorylation | FIIFEDSSKSWVLWK EEEEECCCCCEEEEE | 42.93 | 29899451 | |
| 86 | Phosphorylation | IFEDSSKSWVLWKDI EEECCCCCEEEEEEC | 25.10 | 29899451 | |
| 313 | Ubiquitination | GELADTPKSERYEHV CCCCCCCCHHHHHHH | 68.02 | - | |
| 401 | Phosphorylation | EKKGKKKSVGRPPGP CCCCCCCCCCCCCCH | 38.39 | 28066266 | |
| 417 | Phosphorylation | TRKMIQKTAELPLDK HHHHHHHHCCCCCCH | 14.69 | 27180971 | |
| 442 | Phosphorylation | LPCSIGRTEGIAHSS CCCCCCCCCCCCCCC | 33.09 | 25619855 | |
| 448 | Phosphorylation | RTEGIAHSSNTSDVD CCCCCCCCCCCCCCC | 19.09 | 25619855 | |
| 449 | Phosphorylation | TEGIAHSSNTSDVDL CCCCCCCCCCCCCCC | 33.97 | 25619855 | |
| 451 | Phosphorylation | GIAHSSNTSDVDLTG CCCCCCCCCCCCCCC | 28.40 | 25619855 | |
| 452 | Phosphorylation | IAHSSNTSDVDLTGA CCCCCCCCCCCCCCC | 39.63 | 25619855 | |
| 457 | Phosphorylation | NTSDVDLTGASSANE CCCCCCCCCCCCCCC | 26.66 | 25619855 | |
| 488 | Phosphorylation | KRTRTGRSWPAAIPH CCCCCCCCCCHHHHH | 38.46 | 27600695 | |
| 513 | Phosphorylation | RALQTQNSEVVKDDE HHHHHCCCCEECCCC | 23.19 | 28973931 | |
| 576 | Phosphorylation | RVLARRVTLDGKVQY EEEEEEEECCCEEEE | 19.81 | 28059163 | |
| 583 | Phosphorylation | TLDGKVQYLVEWEGA ECCCEEEEEEEECCC | 18.72 | 28059163 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTF2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTF2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTF2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| EZH1_MOUSE | Ezh1 | physical | 20064376 | |
| EZH2_MOUSE | Ezh2 | physical | 20064376 | |
| EED_MOUSE | Eed | physical | 20064376 | |
| SUZ12_MOUSE | Suz12 | physical | 20064376 | |
| RBBP4_MOUSE | Rbbp4 | physical | 20064376 | |
| STK38_MOUSE | Stk38 | physical | 20064376 | |
| TRI35_MOUSE | Trim35 | physical | 20064376 | |
| ELL_MOUSE | Ell | physical | 20064376 | |
| ICE1_MOUSE | Ice1 | physical | 20064376 | |
| JARD2_MOUSE | Jarid2 | physical | 20064376 | |
| SUZ12_MOUSE | Suz12 | physical | 22438827 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
