TRI35_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRI35_MOUSE
• UniProt AC: Q8C006
• Protein Name: Tripartite motif-containing protein 35
• Gene Name: Trim35
• Organism: Mus musculus (Mouse).
• Sequence Length: 501
• Subcellular Localization: Cytoplasm . Nucleus. Found predominantly in cytoplasm with a granular distribution. Found in punctuate nuclear bodies in transfected COS and HeLa cells.
• Protein Description: Reduces FGFR1-dependent tyrosine phosphorylation of PKM, inhibiting PKM-dependent lactate production, glucose metabolism, and cell growth (By similarity). Implicated in the cell death mechanism. [PubMed: 12692137]
• Protein Sequence: MEPGPSVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRRCVSGCWEVQTTPSCPVCKERAVPGELRTNHTLNNLVETLLREEAEGARWTGRRSPRPCRAHRAPLTLFCLEDKELLCCACQADARHQEHRVQPIKDTAQDFRAKCKNMEHVLREKAKAFWALRRTYEAIAKHNEVQTTWLEGRIRDEFDKLRDFLRVEEQATLDAMKEESRKKHLQAEEKMKQLAEQTEALAREIERLQMEMKEDDMTFLMKHKSRKRRLFCTVEPAPLQPGLLMDACKYLESLQYRVWKKMLGSVESVPFSLDPNTAAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEVDVGGLPTWRVGVVRVQAHAQAQAQADVGGEGHSHSCYHDTRSGFWYLCRTQGVDGDHCMTSDTATAPLVQAMPRRLRVELECEEGELSFYDSERHCHLYTFHAHFGEVRPYFYLGASRGDGPPEPLRICHLRVSIKEELDI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEPGPSVS -------CCCCCCCC	14.66	-
6	Phosphorylation	--MEPGPSVSPGPSR --CCCCCCCCCCCCC	40.94	26643407
8	Phosphorylation	MEPGPSVSPGPSRSF CCCCCCCCCCCCCCH	28.60	29514104
12	Phosphorylation	PSVSPGPSRSFKEEL CCCCCCCCCCHHHHH	46.61	28066266
23	Phosphorylation	KEELLCAVCYDPFRD HHHHHHHHHCCCCCC	2.79	24719451
71	Phosphorylation	AVPGELRTNHTLNNL CCCCCCCCCHHHHHH	43.93	21454597
81	Phosphorylation	TLNNLVETLLREEAE HHHHHHHHHHHHHHH	24.50	21454597
286	Phosphorylation	DACKYLESLQYRVWK HHHHHHHHHHHHHHH	20.41	28418008
289	Phosphorylation	KYLESLQYRVWKKML HHHHHHHHHHHHHHH	16.66	29176673

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRI35_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRI35_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRI35_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IRF7_MOUSE	Irf7	physical	25907537

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.