| UniProt ID | MSX1_MOUSE | |
|---|---|---|
| UniProt AC | P13297 | |
| Protein Name | Homeobox protein MSX-1 | |
| Gene Name | Msx1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 303 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Acts as a transcriptional repressor. May play a role in limb-pattern formation. Acts in cranofacial development and specifically in odontogenesis.. | |
| Protein Sequence | MAPAAAMTSLPLGVKVEDSAFAKPAGGGVGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRAALPVAPVGLYTAHVGYSMYHLT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Sumoylation | TSLPLGVKVEDSAFA CCCCCCCEEECCCCC | 11.84 | - | |
| 133 | Sumoylation | LPEDALVKAESPEKL CCHHHCEECCCHHHH | 60.10 | - | |
| 150 | Dimethylation | TPWMQSPRFSPPPAR CCCCCCCCCCCCCHH | 18.26 | - | |
| 150 | Methylation | TPWMQSPRFSPPPAR CCCCCCCCCCCCCHH | 18.26 | 18962877 | |
| 152 | Phosphorylation | WMQSPRFSPPPARRL CCCCCCCCCCCHHHC | 41.44 | 27180971 | |
| 157 | Dimethylation | RFSPPPARRLSPPAC CCCCCCHHHCCCCCC | 11.43 | - | |
| 157 | Methylation | RFSPPPARRLSPPAC CCCCCCHHHCCCCCC | 11.43 | 18962885 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSX1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSX1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSX1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TBP_MOUSE | Tbp | physical | 20211142 | |
| TLE4_MOUSE | Tle4 | physical | 16002402 | |
| AES_MOUSE | Aes | physical | 16002402 | |
| MSX1_MOUSE | Msx1 | physical | 16002402 | |
| PO2F1_MOUSE | Pou2f1 | physical | 16002402 | |
| H15_MOUSE | Hist1h1b | physical | 15192231 | |
| H11_MOUSE | Hist1h1a | physical | 15192231 | |
| MSHR_MOUSE | Mc1r | physical | 9454589 | |
| MC3R_MOUSE | Mc3r | physical | 9454589 | |
| MC4R_MOUSE | Mc4r | physical | 9454589 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...