AES_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AES_MOUSE
• UniProt AC: P63002
• Protein Name: Amino-terminal enhancer of split
• Gene Name: Aes
• Organism: Mus musculus (Mouse).
• Sequence Length: 197
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional corepressor. Acts as dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Essential for the transcriptional repressor activity of SIX3 during retina and lens development..
• Protein Sequence: MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQTHLSKEDKNGHDGDTHQEDDGEKSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of AES_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AES_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AES_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AES_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SIX3_MOUSE	Six3	physical	12050133
SIX6_MOUSE	Six6	physical	12050133
TLE4_MOUSE	Tle4	physical	16002402
AES_MOUSE	Aes	physical	16002402
MSX1_MOUSE	Msx1	physical	16002402
PO2F1_MOUSE	Pou2f1	physical	16002402
TLE1_MOUSE	Tle1	physical	21251616

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.