UniProt ID | SIX6_MOUSE | |
---|---|---|
UniProt AC | Q9QZ28 | |
Protein Name | Homeobox protein SIX6 | |
Gene Name | Six6 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 246 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in eye development.. | |
Protein Sequence | MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGPGRVLRSEGEGTPEVLGVASSPAASLSSKAATSAISITSSDSECDI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
212 | Phosphorylation | LRSEGEGTPEVLGVA EECCCCCCCCCEEEE | 16.39 | - | |
221 | Phosphorylation | EVLGVASSPAASLSS CCEEEECCCCHHCCC | 14.60 | - | |
225 | Phosphorylation | VASSPAASLSSKAAT EECCCCHHCCCCCCC | 30.78 | - | |
227 | Phosphorylation | SSPAASLSSKAATSA CCCCHHCCCCCCCCC | 27.57 | - | |
228 | Phosphorylation | SPAASLSSKAATSAI CCCHHCCCCCCCCCC | 31.44 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIX6_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIX6_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIX6_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VAX2_MOUSE | Vax2 | physical | 20211142 | |
TF2AY_MOUSE | Gtf2a1l | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...