| UniProt ID | SIX6_MOUSE | |
|---|---|---|
| UniProt AC | Q9QZ28 | |
| Protein Name | Homeobox protein SIX6 | |
| Gene Name | Six6 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 246 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in eye development.. | |
| Protein Sequence | MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGPGRVLRSEGEGTPEVLGVASSPAASLSSKAATSAISITSSDSECDI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 212 | Phosphorylation | LRSEGEGTPEVLGVA EECCCCCCCCCEEEE | 16.39 | - | |
| 221 | Phosphorylation | EVLGVASSPAASLSS CCEEEECCCCHHCCC | 14.60 | - | |
| 225 | Phosphorylation | VASSPAASLSSKAAT EECCCCHHCCCCCCC | 30.78 | - | |
| 227 | Phosphorylation | SSPAASLSSKAATSA CCCCHHCCCCCCCCC | 27.57 | - | |
| 228 | Phosphorylation | SPAASLSSKAATSAI CCCHHCCCCCCCCCC | 31.44 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIX6_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIX6_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIX6_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VAX2_MOUSE | Vax2 | physical | 20211142 | |
| TF2AY_MOUSE | Gtf2a1l | physical | 20211142 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...