VAX2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VAX2_MOUSE
• UniProt AC: Q9WTP9
• Protein Name: Ventral anterior homeobox 2
• Gene Name: Vax2
• Organism: Mus musculus (Mouse).
• Sequence Length: 292
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that may function in dorsoventral specification of the forebrain. Regulates the expression of Wnt signaling antagonists including the expression of a truncated TCF7L2 isoform that cannot bind CTNNB1 and acts therefore as a potent dominant-negative Wnt antagonist. Plays a crucial role in eye development and, in particular, in the specification of the ventral optic vesicle. May be a regulator of axial polarization in the retina..
• Protein Sequence: MGDGGAERDRGPKRREEPGGRSGRHGEHRGAEDLRADTGSASPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNVLRLLEQGRLLSVPRAPSLLALTPGLPGLPASHRGTSLVDPRNSSPRLNPMPSASASSPLPPPLPAICFSSAPLLDLPAGYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	DLRADTGSASPREIA HHHCCCCCCCHHHHC	27.89	24719451
42	Phosphorylation	RADTGSASPREIAGT HCCCCCCCHHHHCCC	26.62	24719451
52	Phosphorylation	EIAGTSASSPAGSRE HHCCCCCCCCCCCCC	36.30	28066266
53	Phosphorylation	IAGTSASSPAGSRES HCCCCCCCCCCCCCC	20.63	28066266
57	Phosphorylation	SASSPAGSRESGGDS CCCCCCCCCCCCCCC	34.67	24719451
108	Phosphorylation	RPKRTRTSFTAEQLY CCCCCCCCCCHHHHH	19.80	20139300
115	Phosphorylation	SFTAEQLYRLEMEFQ CCCHHHHHHHHHHHH	16.91	20139300
170	Phosphorylation	RDLEKRASSSASEAF HHHHHHHHHHHHHHH	28.94	22817900
171	Phosphorylation	DLEKRASSSASEAFA HHHHHHHHHHHHHHH	29.01	21454597
180	Phosphorylation	ASEAFATSNVLRLLE HHHHHHHHHHHHHHH	22.85	21454597
193	Phosphorylation	LEQGRLLSVPRAPSL HHCCCCCCCCCCCHH	34.37	21454597
282	Phosphorylation	LEQQKVGSPGQSDKK HHHHCCCCCCCCCCC	28.92	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
170	S	Phosphorylation	Kinase	PRKACA	P17612	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VAX2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VAX2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TF2AA_MOUSE	Gtf2a1	physical	20211142
GMEB2_MOUSE	Gmeb2	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.