UniProt ID | TF2AA_MOUSE | |
---|---|---|
UniProt AC | Q99PM3 | |
Protein Name | Transcription initiation factor IIA subunit 1 | |
Gene Name | Gtf2a1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 378 | |
Subcellular Localization | Nucleus. | |
Protein Description | TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity (By similarity).. | |
Protein Sequence | MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHQHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLLQHMNASSITSAAATAATLALPAGVTPVQQLLTNSGQLLQVVRAANGAQYILQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPAPAQAPMPAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MANSANTNT ------CCCCCCCCH | 20.77 | - | |
282 | Phosphorylation | VDGTGDTSSEEDEDE ECCCCCCCCCCCCCC | 40.26 | - | |
283 | Phosphorylation | DGTGDTSSEEDEDEE CCCCCCCCCCCCCCC | 47.28 | - | |
318 | Phosphorylation | VEEEPLNSEDDVSDE CCCCCCCCCCCCCHH | 50.51 | 26525534 | |
323 | Phosphorylation | LNSEDDVSDEEGQEL CCCCCCCCHHHHHCH | 46.42 | 26525534 | |
333 | Phosphorylation | EGQELFDTENVVVCQ HHHCHHCCCCEEEEE | 23.33 | 26525534 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
282 | S | Phosphorylation | Kinase | TAF1 | Q80UV9 | Uniprot |
283 | S | Phosphorylation | Kinase | TAF1 | Q80UV9 | Uniprot |
318 | S | Phosphorylation | Kinase | TAF1 | Q80UV9 | Uniprot |
323 | S | Phosphorylation | Kinase | TAF1 | Q80UV9 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TF2AA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TF2AA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNPC4_MOUSE | Snapc4 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...