MSHR_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MSHR_MOUSE
• UniProt AC: Q01727
• Protein Name: Melanocyte-stimulating hormone receptor
• Gene Name: Mc1r
• Organism: Mus musculus (Mouse).
• Sequence Length: 315
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase..
• Protein Sequence: MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	N-linked_Glycosylation	LLGSLNSNATSHLGL HHHHHCCCCCCCCCC	46.28	-
27	N-linked_Glycosylation	SHLGLATNQSEPWCL CCCCCCCCCCCCEEE	37.46	-
313	S-palmitoylation	TLKEVLLCSW----- HHHHHHHHCC-----	3.29	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MSHR_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MSHR_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MSHR_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of MSHR_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.