dbPTM

MC4R_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MC4R_MOUSE
UniProt AC	P56450
Protein Name	Melanocortin receptor 4
Gene Name	Mc4r
Organism	Mus musculus (Mouse).
Sequence Length	332
Subcellular Localization	Cell membrane Multi-pass membrane protein .
Protein Description	Receptor specific to the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. Plays a central role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP)..
Protein Sequence	MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTNMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELSSRY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	N-linked_Glycosylation	------MNSTHHHGM ------CCCCCCCCC	56.46	-
17	N-linked_Glycosylation	YTSLHLWNRSSYGLH EECEEEECCCCCCCC	40.07	-
26	N-linked_Glycosylation	SSYGLHGNASESLGK CCCCCCCCHHHHCCC	29.55	-
108	N-linked_Glycosylation	TIVITLLNSTDTDAQ EEEEEECCCCCCCCC	46.07	-
318	S-palmitoylation	KTFKEIICFYPLGGI HHHHHHHHHEECCHH	3.08	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MC4R_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MC4R_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MC4R_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ATRN1_MOUSE	Atrnl1	physical	14531729

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MC4R_MOUSE

Related Literatures of Post-Translational Modification