UniProt ID | MMP26_HUMAN | |
---|---|---|
UniProt AC | Q9NRE1 | |
Protein Name | Matrix metalloproteinase-26 | |
Gene Name | MMP26 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 261 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
Protein Description | May hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. Is also able to activate progelatinase B.. | |
Protein Sequence | MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Acetylation | VPPAADHKGWDFVEG CCCCCCCCCHHHHHH | 63.34 | 11566365 | |
35 | Phosphorylation | GWDFVEGYFHQFFLT CHHHHHHHHHHHCCC | 5.60 | - | |
44 | Acetylation | HQFFLTKKESPLLTQ HHHCCCCCCCCCCCH | 59.18 | 11566373 | |
46 | Phosphorylation | FFLTKKESPLLTQET HCCCCCCCCCCCHHH | 29.72 | - | |
50 | Phosphorylation | KKESPLLTQETQTQL CCCCCCCCHHHHHHH | 31.85 | - | |
64 | N-linked_Glycosylation | LLQQFHRNGTDLLDM HHHHHHHCCCCHHHH | 49.50 | UniProtKB CARBOHYD | |
221 | N-linked_Glycosylation | LGLQHSGNQSSIMYP CCCCCCCCCCCEECE | 41.39 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MMP26_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MMP26_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MMP26_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HEMH_HUMAN | FECH | physical | 28514442 | |
MCAT_HUMAN | SLC25A20 | physical | 28514442 | |
PP1RA_HUMAN | PPP1R10 | physical | 28514442 | |
EFR3A_HUMAN | EFR3A | physical | 28514442 | |
GBB2_HUMAN | GNB2 | physical | 28514442 | |
PTPRK_HUMAN | PTPRK | physical | 28514442 | |
OZF_HUMAN | ZNF146 | physical | 28514442 | |
DEFM_HUMAN | physical | 28514442 | ||
AGRL3_HUMAN | LPHN3 | physical | 28514442 | |
LAMB2_HUMAN | LAMB2 | physical | 28514442 | |
EPHA4_HUMAN | EPHA4 | physical | 28514442 | |
UQCC3_HUMAN | UQCC3 | physical | 28514442 | |
NDKM_HUMAN | NME4 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...