UniProt ID | UQCC3_HUMAN | |
---|---|---|
UniProt AC | Q6UW78 | |
Protein Name | Ubiquinol-cytochrome-c reductase complex assembly factor 3 {ECO:0000312|HGNC:HGNC:34399} | |
Gene Name | UQCC3 {ECO:0000312|HGNC:HGNC:34399} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 93 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Required for the assembly of the ubiquinol-cytochrome c reductase complex (mitochondrial respiratory chain complex III or cytochrome b-c1 complex), mediating cytochrome b recruitment and probably stabilization within the complex. Thereby, plays an important role in ATP production by mitochondria. Cardiolipin-binding protein, it may also control the cardiolipin composition of mitochondria membranes and their morphology.. | |
Protein Sequence | MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATTQENVAWRKNWMVGGEGGAGGRSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MDSLRKMLIS -----CHHHHHHHHH | 26091039 | ||
35 | Ubiquitination | VTPGERRKQEMLKEM ECCCHHHHHHHHHHC | 22817900 | ||
40 | Ubiquitination | RRKQEMLKEMPLQDP HHHHHHHHHCCCCCC | 21890473 | ||
56 | O-linked_Glycosylation | SREEAARTQQLLLAT HHHHHHHHHHHHHHH | 55831859 | ||
63 | O-linked_Glycosylation | TQQLLLATLQEAATT HHHHHHHHHHHHHHC | 51464457 | ||
69 | O-linked_Glycosylation | ATLQEAATTQENVAW HHHHHHHHCHHHHHH | 55831871 | ||
70 | O-linked_Glycosylation | TLQEAATTQENVAWR HHHHHHHCHHHHHHH | 51464463 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UQCC3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UQCC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UQCC3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FLOT2_HUMAN | FLOT2 | physical | 22939629 | |
IMPA3_HUMAN | IMPAD1 | physical | 22939629 | |
NDUBA_HUMAN | NDUFB10 | physical | 22939629 | |
SERA_HUMAN | PHGDH | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...