dbPTM

MCMBP_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MCMBP_ARATH
UniProt AC	Q501D5
Protein Name	Mini-chromosome maintenance complex-binding protein
Gene Name	ETG1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	589
Subcellular Localization	Nucleus . Associates with the replisome complex.
Protein Description	Associated component of the MCM complex that acts as a regulator of DNA replication. Binds to the MCM complex during late S phase and may act by promoting the disassembly of the MCM complex from chromatin. Required for sister chromatid cohesion..
Protein Sequence	MGGPAYDCLTNPLGAVRFSFVNALSSGYDPASSVGKDWGVVDLFRHYFSDESAISQVPILDSSSIKWVQPKTLVRFRGMIQDMLGNEFYAGAYKDDSTWRTNKYSDVSQFPEGSSTEIQVWERRLLYCVPVPGKNQWTECSSQELKNRFLDLTGQNREKRVRVDEEMTDSMDSSTLEAGRNGSPFKKMKVGEATSSASESQVPQTSGIPPATSADSLPCLVKIYDSPESDLKLNDVVEFLGVLTFDPIVMMDTDTLDENSDALSEAESVQMPSGKVPRLHCLIHRKLETQHFLHGSSLLPEPKSPQIFKEIRESLMKYLTGLLGNDHIAAQFLLLHLLSKVHGRVDNVAVGKLSLNLIHLNKESMSIFGTQLSGALKSLLPFTQSIPLTIEYLNTASFGPKKDYGINRLMPGVLQIADGTHLILDETELQPGTLNSVGVENANLLKNLLECQKVEYDFQYYKMEMATDVQMLIFSEGKSNIMPADLVLPLQPSQVNSLEVITPETAETWRCYLATCKSLSHSIGQELQQVVENDLVAARQTDRSLGSQDLSRLLTMARMMSVSYGETTLSLEHWQMVLELERLRKERLK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MCMBP_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MCMBP_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MCMBP_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MCMBP_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MCM5_ARATH	MCM5	physical	20706207
MCM6_ARATH	MCM6	physical	20706207
MCM7_ARATH	PRL	physical	20706207
MCM2_ARATH	MCM2	physical	20706207
FB90_ARATH	AT1G77880	physical	20706207
MCM3_ARATH	MCM3	physical	20706207
MCM4_ARATH	MCM4	physical	20706207
RPB9A_ARATH	NRPB9A	physical	20706207
SAC5_ARATH	AT1G17340	physical	20706207
TCPA_ARATH	TCP-1	physical	20706207

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MCMBP_ARATH

Related Literatures of Post-Translational Modification