UniProt ID | MCMBP_ARATH | |
---|---|---|
UniProt AC | Q501D5 | |
Protein Name | Mini-chromosome maintenance complex-binding protein | |
Gene Name | ETG1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 589 | |
Subcellular Localization | Nucleus . Associates with the replisome complex. | |
Protein Description | Associated component of the MCM complex that acts as a regulator of DNA replication. Binds to the MCM complex during late S phase and may act by promoting the disassembly of the MCM complex from chromatin. Required for sister chromatid cohesion.. | |
Protein Sequence | MGGPAYDCLTNPLGAVRFSFVNALSSGYDPASSVGKDWGVVDLFRHYFSDESAISQVPILDSSSIKWVQPKTLVRFRGMIQDMLGNEFYAGAYKDDSTWRTNKYSDVSQFPEGSSTEIQVWERRLLYCVPVPGKNQWTECSSQELKNRFLDLTGQNREKRVRVDEEMTDSMDSSTLEAGRNGSPFKKMKVGEATSSASESQVPQTSGIPPATSADSLPCLVKIYDSPESDLKLNDVVEFLGVLTFDPIVMMDTDTLDENSDALSEAESVQMPSGKVPRLHCLIHRKLETQHFLHGSSLLPEPKSPQIFKEIRESLMKYLTGLLGNDHIAAQFLLLHLLSKVHGRVDNVAVGKLSLNLIHLNKESMSIFGTQLSGALKSLLPFTQSIPLTIEYLNTASFGPKKDYGINRLMPGVLQIADGTHLILDETELQPGTLNSVGVENANLLKNLLECQKVEYDFQYYKMEMATDVQMLIFSEGKSNIMPADLVLPLQPSQVNSLEVITPETAETWRCYLATCKSLSHSIGQELQQVVENDLVAARQTDRSLGSQDLSRLLTMARMMSVSYGETTLSLEHWQMVLELERLRKERLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MCMBP_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MCMBP_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCMBP_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCMBP_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MCM5_ARATH | MCM5 | physical | 20706207 | |
MCM6_ARATH | MCM6 | physical | 20706207 | |
MCM7_ARATH | PRL | physical | 20706207 | |
MCM2_ARATH | MCM2 | physical | 20706207 | |
FB90_ARATH | AT1G77880 | physical | 20706207 | |
MCM3_ARATH | MCM3 | physical | 20706207 | |
MCM4_ARATH | MCM4 | physical | 20706207 | |
RPB9A_ARATH | NRPB9A | physical | 20706207 | |
SAC5_ARATH | AT1G17340 | physical | 20706207 | |
TCPA_ARATH | TCP-1 | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...