MBD2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MBD2_MOUSE
• UniProt AC: Q9Z2E1
• Protein Name: Methyl-CpG-binding domain protein 2
• Gene Name: Mbd2
• Organism: Mus musculus (Mouse).
• Sequence Length: 414
• Subcellular Localization: Nucleus. Nuclear, in discrete foci. Detected at replication foci in late S phase (By similarity)..
• Protein Description: Binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binds hemimethylated DNA as well. Recruits histone deacetylases and DNA methyltransferases. Acts as transcriptional repressor and plays a role in gene silencing. Functions as a scaffold protein, targeting GATAD2A and GATAD2B to chromatin to promote repression (By similarity). May enhance the activation of some unmethylated cAMP-responsive promoters (By similarity). Selectively represses transcription activity of methylated rRNA promoters..
• Protein Sequence: MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAARGGGVCGRGRGRGRGRGRGRGRGRGRGRPQSGGSGLGGDGGGGAGGCGGGSGGGVAPRRDPVPFPSGSSGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKFTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEVDIDMDSGDEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	GESAAGGSGAGGDSA CCCCCCCCCCCHHHH	25.26	30635358
30	Phosphorylation	GSGAGGDSAIEQGGQ CCCCCHHHHHHCCCC	34.13	30635358
39	Phosphorylation	IEQGGQGSALAPSPV HHCCCCCCCCCCCCC	16.54	23984901
44	Phosphorylation	QGSALAPSPVSGVRR CCCCCCCCCCCCCCC	32.12	30352176
47	Phosphorylation	ALAPSPVSGVRREGA CCCCCCCCCCCCCCC	34.65	23984901
61	Methylation	ARGGGRGRGRWKQAA CCCCCCCCCCHHHHH	30.09	18966123
61	Dimethylation	ARGGGRGRGRWKQAA CCCCCCCCCCHHHHH	30.09	-
134	Phosphorylation	RDPVPFPSGSSGPGP CCCCCCCCCCCCCCC	52.25	21454597
136	Phosphorylation	PVPFPSGSSGPGPRG CCCCCCCCCCCCCCC	36.14	21454597
147	Phosphorylation	GPRGPRATESGKRMD CCCCCCCCCCCCCCC	31.78	21454597
182	Phosphorylation	AGKSDVYYFSPSGKK CCCCCEEEECCCCCC	9.46	28576409
184	Phosphorylation	KSDVYYFSPSGKKFR CCCEEEECCCCCCCC	11.31	25266776
186	Phosphorylation	DVYYFSPSGKKFRSK CEEEECCCCCCCCCH	63.14	25266776
188	Acetylation	YYFSPSGKKFRSKPQ EEECCCCCCCCCHHH	53.74	23806337
188	Succinylation	YYFSPSGKKFRSKPQ EEECCCCCCCCCHHH	53.74	23806337
193	Ubiquitination	SGKKFRSKPQLARYL CCCCCCCHHHHHHHH	32.31	-
410	Phosphorylation	EVDIDMDSGDEA--- CCCCCCCCCCCC---	41.32	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MBD2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MBD2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MBD2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CHD4_HUMAN	CHD4	physical	26496610
TPP1_HUMAN	TPP1	physical	26496610
HDAC1_HUMAN	HDAC1	physical	26496610
HDAC2_HUMAN	HDAC2	physical	26496610
RBBP4_HUMAN	RBBP4	physical	26496610
RBBP7_HUMAN	RBBP7	physical	26496610
RL6_HUMAN	RPL6	physical	26496610
CDKA1_HUMAN	CDK2AP1	physical	26496610
MTA1_HUMAN	MTA1	physical	26496610
KLF4_HUMAN	KLF4	physical	26496610
RASA3_HUMAN	RASA3	physical	26496610
DHX30_HUMAN	DHX30	physical	26496610
RUSC1_HUMAN	RUSC1	physical	26496610
CCD93_HUMAN	CCDC93	physical	26496610
P66A_HUMAN	GATAD2A	physical	26496610
P66B_HUMAN	GATAD2B	physical	26496610
MTA3_HUMAN	MTA3	physical	26496610
DHX36_HUMAN	DHX36	physical	26496610
MTA2_HUMAN	MTA2	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.