IF4E_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IF4E_MOUSE
• UniProt AC: P63073
• Protein Name: Eukaryotic translation initiation factor 4E
• Gene Name: Eif4e
• Organism: Mus musculus (Mouse).
• Sequence Length: 217
• Subcellular Localization: Cytoplasm, P-body. Cytoplasm .
• Protein Description: Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. May play an important role in spermatogenesis through translational regulation of stage-specific mRNAs during germ cell development (By similarity). Its translation stimulation activity is repressed by binding to the complex CYFIP1-FMR1. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates the binding to the mRNA cap..
• Protein Sequence: MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MATVEPETT ------CCCCCCCCC	21.98	-
3	Phosphorylation	-----MATVEPETTP -----CCCCCCCCCC	24.89	25293948
8	Phosphorylation	MATVEPETTPTTNPP CCCCCCCCCCCCCCC	49.11	25293948
9	Phosphorylation	ATVEPETTPTTNPPP CCCCCCCCCCCCCCC	19.58	25293948
11	Phosphorylation	VEPETTPTTNPPPAE CCCCCCCCCCCCCCH	36.79	25293948
12	Phosphorylation	EPETTPTTNPPPAEE CCCCCCCCCCCCCHH	47.10	25293948
22	Phosphorylation	PPAEEEKTESNQEVA CCCHHHCCCCCCCCC	48.18	26643407
24	Phosphorylation	AEEEKTESNQEVANP CHHHCCCCCCCCCCH	49.39	26643407
34	Phosphorylation	EVANPEHYIKHPLQN CCCCHHHHCCCCCCC	15.25	26643407
54	Malonylation	FFKNDKSKTWQANLR EEECCCCCCHHHHHH	60.57	26320211
119	Ubiquitination	RWLITLNKQQRRSDL EEEEECCHHHHHHHH	51.42	-
119	Acetylation	RWLITLNKQQRRSDL EEEEECCHHHHHHHH	51.42	22826441
119	Malonylation	RWLITLNKQQRRSDL EEEEECCHHHHHHHH	51.42	26320211
159	Malonylation	AVVNVRAKGDKIAIW EEEEEEECCCEEEEE	58.01	26320211
162	Malonylation	NVRAKGDKIAIWTTE EEEECCCEEEEEEEE	42.58	26320211
170	Glutathionylation	IAIWTTECENRDAVT EEEEEEEECCCCHHH	5.43	24333276
206	Malonylation	SHADTATKSGSTTKN CCCCCCCCCCCCCCC	50.81	26320211
207	Phosphorylation	HADTATKSGSTTKNR CCCCCCCCCCCCCCE	33.35	26160508
209	Phosphorylation	DTATKSGSTTKNRFV CCCCCCCCCCCCEEC	39.74	18805096
210	Phosphorylation	TATKSGSTTKNRFVV CCCCCCCCCCCEECC	45.36	26160508
211	Phosphorylation	ATKSGSTTKNRFVV- CCCCCCCCCCEECC-	28.19	23140645

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
209	S	Phosphorylation	Kinase	PRKCA	P04409	GPS
209	S	Phosphorylation	Kinase	KPCA	P20444	PhosphoELM
209	S	Phosphorylation	Kinase	MNK1	Q9BUB5	PSP
209	S	Phosphorylation	Kinase	MKNK1	O08605	PhosphoELM
209	S	Phosphorylation	Kinase	MKNK2	Q8CDB0	Uniprot
209	S	Phosphorylation	Kinase	PKC-FAMILY	-	GPS
209	S	Phosphorylation	Kinase	PKC	-	Uniprot
210	T	Phosphorylation	Kinase	MKNK1	Q9BUB5	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IF4E_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IF4E_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IF4G1_HUMAN	EIF4G1	physical	12149653
IF4E_MOUSE	Eif4e	physical	12149653
IF4G3_MOUSE	Eif4g3	physical	16899032
DCC_MOUSE	Dcc	physical	20434207
4EBP2_MOUSE	Eif4ebp2	physical	8939971
4EBP2_MOUSE	Eif4ebp2	physical	20347422
4EBP1_MOUSE	Eif4ebp1	physical	20971826
IF4G1_MOUSE	Eif4g1	physical	20971826
4ET_MOUSE	Eif4enif1	physical	25923732

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Roles of mitogen-activated protein kinase signal-integrating kinases1 and 2 in oxidant-mediated eIF4E phosphorylation.";
Shenberger J.S., Zhang L., Hughlock M.K., Ueda T.,Watanabe-Fukunaga R., Fukunaga R.;
Int. J. Biochem. Cell Biol. 39:1828-1842(2007).
Cited for: PHOSPHORYLATION AT SER-209 BY MKNK2.
PubMed: 17689282