4EBP1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 4EBP1_MOUSE
• UniProt AC: Q60876
• Protein Name: Eukaryotic translation initiation factor 4E-binding protein 1
• Gene Name: Eif4ebp1
• Organism: Mus musculus (Mouse).
• Sequence Length: 117
• Protein Description: Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation (By similarity). Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. [PubMed: 7629182]
• Protein Sequence: MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSAGSSCSQ ------CCCCCCCCC	41.14	-
2	Phosphorylation	------MSAGSSCSQ ------CCCCCCCCC	41.14	30352176
5	Phosphorylation	---MSAGSSCSQTPS ---CCCCCCCCCCCC	28.08	23072105
6	Phosphorylation	--MSAGSSCSQTPSR --CCCCCCCCCCCCC	19.50	26824392
8	Phosphorylation	MSAGSSCSQTPSRAI CCCCCCCCCCCCCCC	38.75	21149613
10	Phosphorylation	AGSSCSQTPSRAIPT CCCCCCCCCCCCCCC	13.62	21149613
12	Phosphorylation	SSCSQTPSRAIPTRR CCCCCCCCCCCCCCC	37.42	21149613
33	Phosphorylation	VQLPPGDYSTTPGGT CCCCCCCCCCCCCCC	17.52	27087446
34	Phosphorylation	QLPPGDYSTTPGGTL CCCCCCCCCCCCCCE	30.46	27087446
35	Phosphorylation	LPPGDYSTTPGGTLF CCCCCCCCCCCCCEE	30.68	27087446
36	Phosphorylation	PPGDYSTTPGGTLFS CCCCCCCCCCCCEEE	17.62	27087446
40	Phosphorylation	YSTTPGGTLFSTTPG CCCCCCCCEEECCCC	30.46	27087446
43	Phosphorylation	TPGGTLFSTTPGGTR CCCCCEEECCCCCEE	34.19	27087446
44	Phosphorylation	PGGTLFSTTPGGTRI CCCCEEECCCCCEEE	29.67	25521595
45	Phosphorylation	GGTLFSTTPGGTRII CCCEEECCCCCEEEE	20.81	27087446
49	Phosphorylation	FSTTPGGTRIIYDRK EECCCCCEEEEEECH	25.30	27087446
53	Phosphorylation	PGGTRIIYDRKFLME CCCEEEEEECHHHHH	13.81	21082442
56	Acetylation	TRIIYDRKFLMECRN EEEEEECHHHHHHCC	39.70	22826441
56	Ubiquitination	TRIIYDRKFLMECRN EEEEEECHHHHHHCC	39.70	-
61	Glutathionylation	DRKFLMECRNSPVAK ECHHHHHHCCCCCCC	2.88	24333276
64	Phosphorylation	FLMECRNSPVAKTPP HHHHHCCCCCCCCCC	11.03	26824392
69	Phosphorylation	RNSPVAKTPPKDLPA CCCCCCCCCCCCCCC	34.78	26824392
81	Phosphorylation	LPAIPGVTSPTSDEP CCCCCCCCCCCCCCC	34.60	27742792
81	O-linked_Glycosylation	LPAIPGVTSPTSDEP CCCCCCCCCCCCCCC	34.60	21840999
82	Phosphorylation	PAIPGVTSPTSDEPP CCCCCCCCCCCCCCC	24.63	27742792
84	Phosphorylation	IPGVTSPTSDEPPMQ CCCCCCCCCCCCCCC	48.88	20469934
85	Phosphorylation	PGVTSPTSDEPPMQA CCCCCCCCCCCCCCC	43.28	22942356
93	Phosphorylation	DEPPMQASQSQLPSS CCCCCCCCHHCCCCC	17.30	137271
95	Phosphorylation	PPMQASQSQLPSSPE CCCCCCHHCCCCCHH	31.05	21082442
99	Phosphorylation	ASQSQLPSSPEDKRA CCHHCCCCCHHHHHC	68.09	21082442
100	Phosphorylation	SQSQLPSSPEDKRAG CHHCCCCCHHHHHCC	30.30	27087446
111	Phosphorylation	KRAGGEESQFEMDI- HHCCCCCHHCCCCC-	35.55	26824392

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
36	T	Phosphorylation	Kinase	RPS6KA5	O75582	GPS
36	T	Phosphorylation	Kinase	MAPK14	Q16539	GPS
36	T	Phosphorylation	Kinase	MTOR	Q9JLN9	PSP
36	T	Phosphorylation	Kinase	MTOR	P42346	PSP
45	T	Phosphorylation	Kinase	MAPK14	Q16539	GPS
45	T	Phosphorylation	Kinase	MTOR	Q9JLN9	PSP
45	T	Phosphorylation	Kinase	MTOR	P42346	PSP
64	S	Phosphorylation	Kinase	RPS6KA5	O75582	GPS
64	S	Phosphorylation	Kinase	MAPK14	Q16539	GPS
64	S	Phosphorylation	Kinase	MTOR	Q9JLN9	PSP
69	T	Phosphorylation	Kinase	MTOR	Q9JLN9	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
36	T	Phosphorylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079
36	T	Phosphorylation	Phosphorylation at Thr-36, Thr-45, Ser-64 and Thr-69, corresponding to the hyperphosphorylated form, is regulated by mTORC1 and abolishes binding to EIF4E.	21183079
36	T	ubiquitylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079
45	T	Phosphorylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079
45	T	Phosphorylation	Phosphorylation at Thr-36, Thr-45, Ser-64 and Thr-69, corresponding to the hyperphosphorylated form, is regulated by mTORC1 and abolishes binding to EIF4E.	21183079
45	T	ubiquitylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079
64	S	Phosphorylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079
64	S	Phosphorylation	Phosphorylation at Thr-36, Thr-45, Ser-64 and Thr-69, corresponding to the hyperphosphorylated form, is regulated by mTORC1 and abolishes binding to EIF4E.	21183079
64	S	ubiquitylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079
69	T	Phosphorylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079
69	T	Phosphorylation	Phosphorylation at Thr-36, Thr-45, Ser-64 and Thr-69, corresponding to the hyperphosphorylated form, is regulated by mTORC1 and abolishes binding to EIF4E.	21183079
69	T	ubiquitylation	Not ubiquitinated when hyperphosphorylated (at Thr-36, Thr-45, Ser-64 and Thr-69) or associated with eIF4E.	21183079

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 4EBP1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of 4EBP1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.