ID3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ID3_MOUSE
• UniProt AC: P41133
• Protein Name: DNA-binding protein inhibitor ID-3
• Gene Name: Id3
• Organism: Mus musculus (Mouse).
• Sequence Length: 119
• Subcellular Localization: Nucleus . Cytoplasm . Nuclear in proliferating cells, translocates to cytosol during cell differentiation.
• Protein Description: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer..
• Protein Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MKALSPVRGCYE ---CCCCCCCCCHHH	26.64	26824392
11	Phosphorylation	LSPVRGCYEAVCCLS CCCCCCHHHHHHHHC	15.11	25168779
31	Phosphorylation	IARGRGKSPSTEEPL HHCCCCCCCCCCCCH	27.23	26643407
33	Phosphorylation	RGRGKSPSTEEPLSL CCCCCCCCCCCCHHH	56.39	26643407
34	Phosphorylation	GRGKSPSTEEPLSLL CCCCCCCCCCCHHHH	47.99	26643407
39	Phosphorylation	PSTEEPLSLLDDMNH CCCCCCHHHHHHHHH	37.29	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ID3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ID3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ID3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYOD1_MOUSE	Myod1	physical	8759016
ID4_MOUSE	Id4	physical	8759016
HTF4_MOUSE	Tcf12	physical	8759016
CSN5_MOUSE	Cops5	physical	15451666
CSN6_MOUSE	Cops6	physical	15451666
CSN7A_MOUSE	Cops7a	physical	15451666
TFE2_MOUSE	Tcf3	physical	8759016
ITF2_MOUSE	Tcf4	physical	8759016

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.