ID4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ID4_MOUSE
• UniProt AC: P41139
• Protein Name: DNA-binding protein inhibitor ID-4
• Gene Name: Id4
• Organism: Mus musculus (Mouse).
• Sequence Length: 161
• Subcellular Localization: Nucleus.
• Protein Description: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation..
• Protein Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHPAGACPVAPPRTPLTALNTDPAGAVNKQGDSILCR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MKAVSPVRPSGR ---CCCCCCCCCCCC	23.65	29895711

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ID4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ID4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ID4_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ID4_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.