HXC12_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HXC12_MOUSE
• UniProt AC: Q8K5B8
• Protein Name: Homeobox protein Hox-C12
• Gene Name: Hoxc12
• Organism: Mus musculus (Mouse).
• Sequence Length: 280
• Subcellular Localization: Nucleus .
• Protein Description: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis..
• Protein Sequence: MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAEGGGGGLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYTASGGGGDGSTGPPHDPPSCQSLESDSSSSLLNEGNKSASAGDPGSLVSPLNPGGGLSASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	AQLPGLPSLSYPRRD CCCCCCCCCCCCCCC	34.68	-
252	Phosphorylation	LSDRLNLSDQQVKIW HHHHCCCCHHHHHHH	32.09	22942356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HXC12_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HXC12_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HXC12_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PAX6_MOUSE	Pax6	physical	20211142
PBX1_MOUSE	Pbx1	physical	20211142
PBX2_MOUSE	Pbx2	physical	20211142
PBX3_MOUSE	Pbx3	physical	20211142
RFXK_MOUSE	Rfxank	physical	20211142
NKX21_MOUSE	Nkx2-1	physical	20211142
JADE1_MOUSE	Jade1	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.