UniProt ID | HXC12_MOUSE | |
---|---|---|
UniProt AC | Q8K5B8 | |
Protein Name | Homeobox protein Hox-C12 | |
Gene Name | Hoxc12 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 280 | |
Subcellular Localization | Nucleus . | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.. | |
Protein Sequence | MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAEGGGGGLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYTASGGGGDGSTGPPHDPPSCQSLESDSSSSLLNEGNKSASAGDPGSLVSPLNPGGGLSASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXC12_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXC12_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXC12_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PAX6_MOUSE | Pax6 | physical | 20211142 | |
PBX1_MOUSE | Pbx1 | physical | 20211142 | |
PBX2_MOUSE | Pbx2 | physical | 20211142 | |
PBX3_MOUSE | Pbx3 | physical | 20211142 | |
RFXK_MOUSE | Rfxank | physical | 20211142 | |
NKX21_MOUSE | Nkx2-1 | physical | 20211142 | |
JADE1_MOUSE | Jade1 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...