NKX21_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NKX21_MOUSE
• UniProt AC: P50220
• Protein Name: Homeobox protein Nkx-2.1
• Gene Name: Nkx2-1 {ECO:0000312|MGI:MGI:108067}
• Organism: Mus musculus (Mouse).
• Sequence Length: 372
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. [PubMed: 22955271 Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1]
• Protein Sequence: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQSHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAGLQGQVSSLSHLNSSGSDYGAMSCSTLLYGRTW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSMSPKHTT ------CCCCCCCCC	28.15	22871156
4	Phosphorylation	----MSMSPKHTTPF ----CCCCCCCCCCC	24.40	21659604
114	Phosphorylation	SASGPGWYGANPDPR CCCCCCCCCCCCCCC	16.57	-
255	Phosphorylation	QQQAQQQSPRRVAVP HHHHHHCCCCCEEEE	18.94	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NKX21_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NKX21_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NKX21_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMCA4_MOUSE	Smarca4	physical	19906647
MIXL1_MOUSE	Mixl1	physical	20211142
HNF4G_MOUSE	Hnf4g	physical	20211142
VSX1_MOUSE	Vsx1	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.