UniProt ID | MIXL1_MOUSE | |
---|---|---|
UniProt AC | Q9WUI0 | |
Protein Name | Homeobox protein MIXL1 | |
Gene Name | Mixl1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 231 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression.. | |
Protein Sequence | MAAAGSQQLQFAEGAAFPIFPAAHPGGQLLPAMRPASGLPAAPHDSRAPAATQCFPNRDSSPTAQTPAGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRRGVFLHCPAPGTEARCLKPQLPLEADVNHVPDPSMTGGGVCTSGSQSFETYSSLSEDIGSKLDSWEEHIFSALGNF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MIXL1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MIXL1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MIXL1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
T2EA_MOUSE | Gtf2e1 | physical | 20211142 | |
TLE6_MOUSE | Tle6 | physical | 20211142 | |
MED16_MOUSE | Med16 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...