dbPTM

MIXL1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MIXL1_MOUSE
UniProt AC	Q9WUI0
Protein Name	Homeobox protein MIXL1
Gene Name	Mixl1
Organism	Mus musculus (Mouse).
Sequence Length	231
Subcellular Localization	Nucleus .
Protein Description	Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression..
Protein Sequence	MAAAGSQQLQFAEGAAFPIFPAAHPGGQLLPAMRPASGLPAAPHDSRAPAATQCFPNRDSSPTAQTPAGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRRGVFLHCPAPGTEARCLKPQLPLEADVNHVPDPSMTGGGVCTSGSQSFETYSSLSEDIGSKLDSWEEHIFSALGNF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
123	Phosphorylation	RERLAALTLLPESRI HHHHHHHHHCCHHHH	22.86	28059163
128	Phosphorylation	ALTLLPESRIQVWFQ HHHHCCHHHHHHHHH	32.51	28059163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MIXL1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MIXL1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MIXL1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
T2EA_MOUSE	Gtf2e1	physical	20211142
TLE6_MOUSE	Tle6	physical	20211142
MED16_MOUSE	Med16	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MIXL1_MOUSE

Related Literatures of Post-Translational Modification