dbPTM

HXB8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HXB8_MOUSE
UniProt AC	P09632
Protein Name	Homeobox protein Hox-B8
Gene Name	Hoxb8
Organism	Mus musculus (Mouse).
Sequence Length	243
Subcellular Localization	Nucleus.
Protein Description	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis..
Protein Sequence	MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEKLERAPETAEQGDAQKGDKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
156	Phosphorylation	GRQTYSRYQTLELEK CCCCCCCHHHHHHHH	10.42	23608596
158	Phosphorylation	QTYSRYQTLELEKEF CCCCCHHHHHHHHHH	17.17	23608596

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HXB8_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HXB8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HXB8_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IRF9_MOUSE	Irf9	physical	20211142
PBX1_MOUSE	Pbx1	physical	20211142
PBX3_MOUSE	Pbx3	physical	20211142
PO2F1_MOUSE	Pou2f1	physical	20211142
STA5B_MOUSE	Stat5b	physical	20211142
ZFP30_MOUSE	Zfp30	physical	20211142
IRF7_MOUSE	Irf7	physical	20211142
ASB1_MOUSE	Asb1	physical	20211142
RPB9_MOUSE	Polr2i	physical	20211142
TF2AY_MOUSE	Gtf2a1l	physical	20211142
PKNX2_MOUSE	Pknox2	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HXB8_MOUSE

Related Literatures of Post-Translational Modification