UniProt ID | HXB8_MOUSE | |
---|---|---|
UniProt AC | P09632 | |
Protein Name | Homeobox protein Hox-B8 | |
Gene Name | Hoxb8 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 243 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.. | |
Protein Sequence | MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEKLERAPETAEQGDAQKGDKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXB8_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXB8_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXB8_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IRF9_MOUSE | Irf9 | physical | 20211142 | |
PBX1_MOUSE | Pbx1 | physical | 20211142 | |
PBX3_MOUSE | Pbx3 | physical | 20211142 | |
PO2F1_MOUSE | Pou2f1 | physical | 20211142 | |
STA5B_MOUSE | Stat5b | physical | 20211142 | |
ZFP30_MOUSE | Zfp30 | physical | 20211142 | |
IRF7_MOUSE | Irf7 | physical | 20211142 | |
ASB1_MOUSE | Asb1 | physical | 20211142 | |
RPB9_MOUSE | Polr2i | physical | 20211142 | |
TF2AY_MOUSE | Gtf2a1l | physical | 20211142 | |
PKNX2_MOUSE | Pknox2 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...