| UniProt ID | ZFP30_MOUSE | |
|---|---|---|
| UniProt AC | Q60585 | |
| Protein Name | Zinc finger protein 30 | |
| Gene Name | Zfp30 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 533 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MAHSTVMFRDVAVGFSQEEWECLSAYERDLYRDVMLENYSHLVSLAGCSISKPDVITLLEQGKEPWMIVRAEKRRWSRDLESRYSSNGLLPEKNTYEINLSPWEIMGRIQRRGPEDSLLGKDFEYKIYEEQENSHRVYFRHVIKTTSGKRPRYRKRTPVSLYQKTPNGEKPYECGECGKAFKVRQQLTFHQRIHTGEKPYECKECGKAFRQCAHLSRHQRIHASDKLYECKKCAKIFTCSSDLRGHQRSHVGEKPYDCKECGKAFRVRGQLMLHQRIHTGEKPYACTECGKSFRQVAHLTRHQRLNSGSSRHECKECGRAFLCSTGLRLHHKLHTGEKPYDCKECGKAFRVRQQLTLHERIHTGEKPFDCKECGKTFSRGYHLTLHQRIHTGEKPYECKECRKFFRRYSELISHQGIHIGEKPYDCKECGKAFRLFSQLTQHQSIHFGEKPYKCMECEKTFRLLSQLTQHQSIHTGEKPYDCKECGKAFRLHSSLIQHQRIHSGEKPYKCTECKKAFRQHSHLTYHQRIHKNL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Asymmetric dimethylarginine | IVRAEKRRWSRDLES EEEHHHHHHCCCHHH | 46.95 | - | |
| 75 | Methylation | IVRAEKRRWSRDLES EEEHHHHHHCCCHHH | 46.95 | 24129315 | |
| 78 | Dimethylation | AEKRRWSRDLESRYS HHHHHHCCCHHHHHC | 45.64 | - | |
| 78 | Methylation | AEKRRWSRDLESRYS HHHHHHCCCHHHHHC | 45.64 | 58856539 | |
| 84 | Phosphorylation | SRDLESRYSSNGLLP CCCHHHHHCCCCCCC | 26.23 | 26060331 | |
| 85 | Phosphorylation | RDLESRYSSNGLLPE CCHHHHHCCCCCCCC | 19.06 | 29233185 | |
| 86 | Phosphorylation | DLESRYSSNGLLPEK CHHHHHCCCCCCCCC | 26.44 | 29233185 | |
| 126 | Acetylation | LGKDFEYKIYEEQEN CCCCEEEEEEECCCC | 31.45 | 6584469 | |
| 144 | Acetylation | VYFRHVIKTTSGKRP EEEEEEEECCCCCCC | 44.66 | 6571457 | |
| 195 | Phosphorylation | TFHQRIHTGEKPYEC EECCCCCCCCCCCCH | 44.67 | 25777480 | |
| 224 | Phosphorylation | RHQRIHASDKLYECK HHCHHCCCCCHHHCC | 22.55 | 19367708 | |
| 238 | Phosphorylation | KKCAKIFTCSSDLRG CCCCEEEEECHHCCC | 18.23 | - | |
| 240 | Phosphorylation | CAKIFTCSSDLRGHQ CCEEEEECHHCCCCC | 24.67 | - | |
| 300 | Phosphorylation | FRQVAHLTRHQRLNS HHHHHHHHHHHHCCC | 19.08 | 28059163 | |
| 310 | Phosphorylation | QRLNSGSSRHECKEC HHCCCCCCHHHHHHH | 40.98 | 28059163 | |
| 363 | Phosphorylation | TLHERIHTGEKPFDC EHHHHHCCCCCCCCH | 44.67 | - | |
| 378 | Phosphorylation | KECGKTFSRGYHLTL HHHCCCCCCCCEEEE | 29.99 | 24719451 | |
| 391 | Phosphorylation | TLHQRIHTGEKPYEC EEEEEECCCCCCCCH | 44.67 | 25777480 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZFP30_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZFP30_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZFP30_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZFP30_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
