UniProt ID | HSP26_DROME | |
---|---|---|
UniProt AC | P02517 | |
Protein Name | Heat shock protein 26 | |
Gene Name | Hsp26 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 208 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSLSTLLSLVDELQEPRSPIYELGLGLHPHSRYVLPLGTQQRRSINGCPCASPICPSSPAGQVLALRREMANRNDIHWPATAHVGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKENGAPNGKDK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLSTLLSL ------CCHHHHHHH | 30.90 | 19429919 | |
4 | Phosphorylation | ----MSLSTLLSLVD ----CCHHHHHHHHH | 15.09 | 19429919 | |
5 | Phosphorylation | ---MSLSTLLSLVDE ---CCHHHHHHHHHH | 36.69 | 19429919 | |
8 | Phosphorylation | MSLSTLLSLVDELQE CCHHHHHHHHHHHCC | 29.47 | 19429919 | |
18 | Phosphorylation | DELQEPRSPIYELGL HHHCCCCCCHHHCCC | 26.77 | 19429919 | |
31 | Phosphorylation | GLGLHPHSRYVLPLG CCCCCCCCCCEEECC | 29.74 | 22817900 | |
39 | Phosphorylation | RYVLPLGTQQRRSIN CCEEECCCCCCCCCC | 29.25 | 22817900 | |
44 | Phosphorylation | LGTQQRRSINGCPCA CCCCCCCCCCCCCCC | 23.69 | 28490779 | |
52 | Phosphorylation | INGCPCASPICPSSP CCCCCCCCCCCCCCC | 22.86 | 28490779 | |
57 | Phosphorylation | CASPICPSSPAGQVL CCCCCCCCCCHHHHH | 44.54 | 28490779 | |
58 | Phosphorylation | ASPICPSSPAGQVLA CCCCCCCCCHHHHHH | 12.15 | 28490779 | |
111 | Phosphorylation | NVKVVDDSILVEGKH CEEEECCCEEECCCC | 17.23 | 22668510 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSP26_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSP26_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSP26_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADRL_DROME | AdipoR | physical | 14605208 | |
ETS4_DROME | Ets98B | physical | 14605208 | |
NICA_DROME | nct | physical | 14605208 | |
RM19_DROME | mRpL19 | physical | 14605208 | |
HSP27_DROME | Hsp27 | physical | 22036573 | |
REF2P_DROME | ref(2)P | physical | 22036573 | |
YPL1_DROME | CG15309 | physical | 22036573 | |
DEFI8_DROME | CG11534 | physical | 22036573 | |
JMJD6_DROME | PSR | physical | 22036573 | |
CP4E2_DROME | Cyp4e2 | physical | 22036573 | |
TGT_DROME | Tgt | physical | 22036573 | |
NDE1_DROME | nudE | physical | 22036573 | |
QTRT2_DROME | CG3434 | physical | 22036573 | |
RS27A_DROME | RpS27A | physical | 24292889 | |
OVO_DROME | ovo | physical | 25242320 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44; SER-52 AND SER-58,AND MASS SPECTROMETRY. |