UniProt ID | GST1_SCHPO | |
---|---|---|
UniProt AC | Q9Y7Q2 | |
Protein Name | Glutathione S-transferase 1 | |
Gene Name | gst1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 229 | |
Subcellular Localization | ||
Protein Description | Involved in the oxidative stress response and detoxification.. | |
Protein Sequence | MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWESDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVISAITRYRNEIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVPQLDFEKEFPRTYSWHQRLLARPASKATFEERSKALDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GST1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GST1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GST1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GST1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GST2_SCHPO | gst2 | genetic | 12063243 | |
GST1_SCHPO | gst1 | physical | 12063243 | |
GST2_SCHPO | gst2 | physical | 12063243 | |
PST2_SCHPO | pst2 | genetic | 19547744 | |
DDB1_SCHPO | ddb1 | genetic | 22681890 | |
YEG5_SCHPO | mga2 | genetic | 22681890 | |
CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
ARF6_SCHPO | arf6 | genetic | 22681890 | |
YAG7_SCHPO | SPAC12G12.07c | genetic | 22681890 | |
SSN3_SCHPO | srb10 | genetic | 22681890 | |
YGK4_SCHPO | SPBC725.04 | genetic | 22681890 | |
RLA2_SCHPO | rpp201 | genetic | 22681890 | |
NOP53_SCHPO | rrp16 | genetic | 22681890 | |
ATP5E_SCHPO | atp15 | genetic | 22681890 | |
YIDH_SCHPO | SPAC227.17c | genetic | 22681890 | |
RL38A_SCHPO | rpl3801 | genetic | 22681890 | |
RL27A_SCHPO | rpl2701 | genetic | 22681890 | |
MED1_SCHPO | pmc2 | genetic | 22681890 | |
RL16B_SCHPO | rpl1601 | genetic | 22681890 | |
RDS1_SCHPO | rds1 | genetic | 22681890 | |
RL17B_SCHPO | rpl1702 | genetic | 22681890 | |
TRM6_SCHPO | gcd10 | genetic | 22681890 | |
RS17A_SCHPO | rps1701 | genetic | 22681890 | |
IWR1_SCHPO | iwr1 | genetic | 22681890 | |
MKH1_SCHPO | mkh1 | genetic | 22681890 | |
AMT2_SCHPO | amt2 | genetic | 22681890 | |
GST1_SCHPO | gst1 | physical | 26771498 | |
GST2_SCHPO | gst2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...