UniProt ID | NOP53_SCHPO | |
---|---|---|
UniProt AC | Q9UUI4 | |
Protein Name | Ribosome biogenesis protein NOP53 {ECO:0000305} | |
Gene Name | rrp16 {ECO:0000312|PomBase:SPAC22F8.09} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 419 | |
Subcellular Localization | Nucleus, nucleolus . Nucleus, nucleoplasm . | |
Protein Description | May play a role in ribosome biogenesis.. | |
Protein Sequence | MGIKERNAPSQYKQSSRKNKRAWRKNIDLEDIESGLEQTRDEEIKGGNVEHKPNDALFVIDTLGDDRIAKRSRKKIKPLKVDQILENKSSIEKVHSHLTNNSTESNKKGKIFSRKELNRLQALVYKNKDGLTATSAASELKNTKQPKESYDVWETNPTVTIPVKRPSTLSKLPESLTENNAKVPNVVIADPGMSYNPDAAAWMKLLDTKGSEELKKEQKRISELEEKERIQKKAFEDKGLVSDQDVNHSIDSDDQSEHEQAETPIPSSKNKRKTRSQRNKIRQRREEELRLLEQKKNEELLRTIDKAPAISKKLQQKDKAEKFSNKAVSSSTTEIKLKKKKFGKHRLPNNPLEIKLGDELTSSLRELKPEGNLFADRYLSLQQRAMVPPSLPVLKKSKYRAKIKEKYSHKDFHLQKNSI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Phosphorylation | IDLEDIESGLEQTRD CCHHHHHHHHHHHCC | 25720772 | ||
242 | Phosphorylation | FEDKGLVSDQDVNHS HHCCCCCCCCCCCCC | 28889911 | ||
249 | Phosphorylation | SDQDVNHSIDSDDQS CCCCCCCCCCCCCHH | 28889911 | ||
252 | Phosphorylation | DVNHSIDSDDQSEHE CCCCCCCCCCHHHHH | 28889911 | ||
256 | Phosphorylation | SIDSDDQSEHEQAET CCCCCCHHHHHHCCC | 28889911 | ||
418 | Phosphorylation | DFHLQKNSI------ CHHCCCCCC------ | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOP53_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOP53_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOP53_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NOP53_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...