UniProt ID | FRAT1_HUMAN | |
---|---|---|
UniProt AC | Q92837 | |
Protein Name | Proto-oncogene FRAT1 | |
Gene Name | FRAT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 279 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Positively regulates the Wnt signaling pathway by stabilizing beta-catenin through the association with GSK-3. May play a role in tumor progression and collaborate with PIM1 and MYC in lymphomagenesis.. | |
Protein Sequence | MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
88 | Phosphorylation | VPADKARSPAVPLLL CCCCHHCCCCCCCCC | 23.28 | 28450419 | |
128 | Phosphorylation | VRGRAAPYCVAELAT CCCCCCCCEEEHHHC | 8.53 | 22210691 | |
135 | Phosphorylation | YCVAELATGPSALSP CEEEHHHCCCCCCCC | 63.35 | 22210691 | |
138 | Phosphorylation | AELATGPSALSPLPP EHHHCCCCCCCCCCC | 43.09 | 22210691 | |
179 | Phosphorylation | WLRGAAASRRLQQRR HHHHHHHHHHHHHHC | 17.13 | 30206219 | |
188 | Phosphorylation | RLQQRRGSQPETRTG HHHHHCCCCCCCCCC | 40.53 | 22817900 | |
214 | Ubiquitination | VLSGNLIKEAVRRLH HHCCHHHHHHHHHHH | 42.67 | - | |
241 | Phosphorylation | RPLLGPLSAPVHEPP CCCCCCCCCCCCCCC | 33.39 | 27080861 | |
249 | Phosphorylation | APVHEPPSPRSPRAA CCCCCCCCCCCCCHH | 43.60 | 24719451 | |
252 | Phosphorylation | HEPPSPRSPRAACSD CCCCCCCCCCHHCCC | 23.32 | - | |
258 | Phosphorylation | RSPRAACSDPGASGR CCCCHHCCCCCCCCC | 41.96 | 28348404 | |
279 | Phosphorylation | DGVLVPGS------- CCCCCCCC------- | 30.86 | 23403867 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FRAT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FRAT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DVL1_HUMAN | DVL1 | physical | 10428961 | |
GASP2_HUMAN | GPRASP2 | physical | 21988832 | |
LAMC3_HUMAN | LAMC3 | physical | 21988832 | |
K1C18_HUMAN | KRT18 | physical | 21988832 | |
GRN_HUMAN | GRN | physical | 21988832 | |
PLS1_HUMAN | PLSCR1 | physical | 21988832 | |
PSA3_HUMAN | PSMA3 | physical | 21988832 | |
LTBP4_HUMAN | LTBP4 | physical | 21988832 | |
KCNK5_HUMAN | KCNK5 | physical | 21988832 | |
LMAN2_HUMAN | LMAN2 | physical | 21988832 | |
TDRD7_HUMAN | TDRD7 | physical | 21988832 | |
RABE2_HUMAN | RABEP2 | physical | 21988832 | |
GSK3A_HUMAN | GSK3A | physical | 26496610 | |
GSK3B_HUMAN | GSK3B | physical | 26496610 | |
RASK_HUMAN | KRAS | physical | 26496610 | |
PIAS1_HUMAN | PIAS1 | physical | 26496610 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-88, AND MASSSPECTROMETRY. |