| UniProt ID | FIT3_YEAST | |
|---|---|---|
| UniProt AC | Q08907 | |
| Protein Name | Facilitator of iron transport 3 | |
| Gene Name | FIT3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 204 | |
| Subcellular Localization |
Secreted, cell wall . Membrane Lipid-anchor, GPI-anchor . |
|
| Protein Description | Involved in the uptake of non-siderophore and siderohpore sources of iron. Has a role in the retention of iron in the cell wall and periplasmic space.. | |
| Protein Sequence | MKFSSALVLSAVAATALAESITTTITATKNGHVYTKTVTQDATFVWGGEDSYASSTSAAESSAAETSAAETSAAATTSAAATTSAAETSSAAETSSADEGSGSSITTTITATKNGHVYTKTVTQDATFVWTGEGSSNTWSPSSTSTSSEAATSSASTTATTTAETSSSATSSSTAELSSYTGAADAITAGTGLMGAALAAVMLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 182 | GPI-anchor | AELSSYTGAADAITA EEHHHHCCHHHHHHH | 15.55 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FIT3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FIT3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FIT3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FUN30_YEAST | FUN30 | genetic | 20093466 | |
| YD186_YEAST | YDL186W | genetic | 20093466 | |
| RMD1_YEAST | RMD1 | genetic | 20093466 | |
| DYL1_YEAST | DYN2 | genetic | 20093466 | |
| RMT2_YEAST | RMT2 | genetic | 20093466 | |
| THIK_YEAST | POT1 | genetic | 20093466 | |
| ELF1_YEAST | ELF1 | genetic | 20093466 | |
| VRP1_YEAST | VRP1 | genetic | 20093466 | |
| SOK2_YEAST | SOK2 | genetic | 20093466 | |
| MSB4_YEAST | MSB4 | genetic | 20093466 | |
| YP089_YEAST | YPR089W | genetic | 20093466 | |
| FUN30_YEAST | FUN30 | genetic | 27708008 | |
| REI1_YEAST | REI1 | genetic | 27708008 | |
| RMD1_YEAST | RMD1 | genetic | 27708008 | |
| YD186_YEAST | YDL186W | genetic | 27708008 | |
| DYL1_YEAST | DYN2 | genetic | 27708008 | |
| RMT2_YEAST | RMT2 | genetic | 27708008 | |
| PMT6_YEAST | PMT6 | genetic | 27708008 | |
| THIK_YEAST | POT1 | genetic | 27708008 | |
| CSI2_YEAST | CSI2 | genetic | 27708008 | |
| MSB4_YEAST | MSB4 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
