FDL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FDL1_ARATH
• UniProt AC: Q9FZ70
• Protein Name: F-box/FBD/LRR-repeat protein At1g13570
• Gene Name: At1g13570
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 416
• Protein Sequence: MGESPDFISDLPQSIIENILTRLSIRDAIRTSVLSSKWRYKWSTLTDLVFDEKCVSPSNDRCVVETNLVRFITGVLLLHQGPIHKFQLSTSFKQCRPDIDQWLLFLSRNGIKELVLKLGEGEFRVPACLFNCLKLTCLELCHCEFDPPQYFKGFSYLKSLNLHQILVAPEVIESLISGCPLLEFLSLSYFDSLVLSISAPNLMYLYLDGEFKDIFLENTPKLVAISVSMYMHEDVTDFEQSSDYNLVKFLGGVPLLEKLVGYIYFTKYLSIGDDPGRLPLTYIHLKTIELYQVCFEDADEVLVLLRLVTHSPNLKELKVSASPVQPFPLEEEGFDLFERDYFDYKLPSLESVKITDASGIRYELEFIRFLLGTSPVLETVTVSSSLSDKDAKMDMVIELLRYPRVSPRAQLLFLQD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
90	Phosphorylation	IHKFQLSTSFKQCRP CCCEEECCCHHHHCC	46.93	19880383
91	Phosphorylation	HKFQLSTSFKQCRPD CCEEECCCHHHHCCC	27.37	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FDL1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FDL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FDL1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ASK3_ARATH	SK3	physical	23166809
ASK4_ARATH	SK4	physical	23166809
ASK9_ARATH	SK9	physical	23166809
ASK11_ARATH	SK11	physical	23166809
ASK12_ARATH	SK12	physical	23166809
ASK13_ARATH	SK13	physical	23166809
ASK14_ARATH	SK14	physical	23166809
SKP1A_ARATH	SKP1	physical	23166809
SKP1B_ARATH	ASK2	physical	23166809

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.