| UniProt ID | EF1G_DROME | |
|---|---|---|
| UniProt AC | Q9NJH0 | |
| Protein Name | Elongation factor 1-gamma | |
| Gene Name | Ef1gamma | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 431 | |
| Subcellular Localization | ||
| Protein Description | Probably plays a role in anchoring the complex to other cellular components.. | |
| Protein Sequence | MVKGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKKEAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAKSIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGEDGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKDGRKFNQGKIFK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | Acetylation | VKVADNFKFGETNKS EEEECCCCCCCCCCC | 59.73 | 21791702 | |
| 42 | Acetylation | FKFGETNKSAEFLKK CCCCCCCCCHHHHHH | 59.47 | 21791702 | |
| 48 | Acetylation | NKSAEFLKKFPGGKV CCCHHHHHHCCCCCC | 58.66 | 21791702 | |
| 201 | Acetylation | KQVQAVVKDYKLCEK HHHHHHHCCCCHHHH | 49.06 | 21791702 | |
| 215 | Acetylation | KALVFDPKKYAEFQA HHCCCCHHHHHHHHH | 61.33 | 21791702 | |
| 428 | Acetylation | GRKFNQGKIFK---- CCCCCCCCCCC---- | 34.89 | 21791702 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EF1G_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EF1G_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EF1G_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| INSL7_DROME | Ilp7 | physical | 14605208 | |
| CRN_DROME | crn | physical | 14605208 | |
| EF1B_DROME | Ef1beta | physical | 14605208 | |
| ARCH_DROME | CG6353 | physical | 14605208 | |
| NIPSN_DROME | Nipsnap | physical | 14605208 | |
| SXL_DROME | Sxl | physical | 14605208 | |
| OSGEP_DROME | CG4933 | physical | 22036573 | |
| EF1D_DROME | eEF1delta | physical | 22036573 | |
| YC17_DROME | CG16817 | physical | 22036573 | |
| DOA_DROME | Doa | physical | 19841092 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
