dbPTM

EF1B_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EF1B_DROME
UniProt AC	O96827
Protein Name	Probable elongation factor 1-beta
Gene Name	eEF1beta {ECO:0000312\|FlyBase:FBgn0028737}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	222
Subcellular Localization
Protein Description	EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP..
Protein Sequence	MAFGDVTTPQGLKELNAFLADNSYISGYTPSKADLSVFDALGKAPSADNVNVARWYRHIASFEAAERAAWSGTPLPQLAGGKPTVAAAAKPAADDDDDVDLFGSDDEEDEEAERIKQERVAAYAAKKSKKPALIAKSSVLLDVKPWDDETDMKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVIEDDKVSIDLLQEKIEEFEDFVQSVDIAAFNKI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	Phosphorylation	DALGKAPSADNVNVA HHCCCCCCCCCCCHH	53.79	19429919
71	Phosphorylation	AAERAAWSGTPLPQL HHHHHHHCCCCCHHH	28.23	23607784
73	Phosphorylation	ERAAWSGTPLPQLAG HHHHHCCCCCHHHCC	19.01	23607784
84	Phosphorylation	QLAGGKPTVAAAAKP HHCCCCCCEEEECCC	26.68	22668510
104	Phosphorylation	DDVDLFGSDDEEDEE CCCCCCCCCCCHHHH	34.26	21082442
130	Acetylation	YAAKKSKKPALIAKS HHHHCCCCCEEEEEC	42.48	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EF1B_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EF1B_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EF1B_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
QCR9_DROME	ox	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EF1B_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104, AND MASSSPECTROMETRY.	18327897 [Abstract]