UniProt ID | EF1B_DROME | |
---|---|---|
UniProt AC | O96827 | |
Protein Name | Probable elongation factor 1-beta | |
Gene Name | eEF1beta {ECO:0000312|FlyBase:FBgn0028737} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 222 | |
Subcellular Localization | ||
Protein Description | EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.. | |
Protein Sequence | MAFGDVTTPQGLKELNAFLADNSYISGYTPSKADLSVFDALGKAPSADNVNVARWYRHIASFEAAERAAWSGTPLPQLAGGKPTVAAAAKPAADDDDDVDLFGSDDEEDEEAERIKQERVAAYAAKKSKKPALIAKSSVLLDVKPWDDETDMKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVIEDDKVSIDLLQEKIEEFEDFVQSVDIAAFNKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | DALGKAPSADNVNVA HHCCCCCCCCCCCHH | 53.79 | 19429919 | |
71 | Phosphorylation | AAERAAWSGTPLPQL HHHHHHHCCCCCHHH | 28.23 | 23607784 | |
73 | Phosphorylation | ERAAWSGTPLPQLAG HHHHHCCCCCHHHCC | 19.01 | 23607784 | |
84 | Phosphorylation | QLAGGKPTVAAAAKP HHCCCCCCEEEECCC | 26.68 | 22668510 | |
104 | Phosphorylation | DDVDLFGSDDEEDEE CCCCCCCCCCCHHHH | 34.26 | 21082442 | |
130 | Acetylation | YAAKKSKKPALIAKS HHHHCCCCCEEEEEC | 42.48 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EF1B_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EF1B_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EF1B_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
QCR9_DROME | ox | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...