UniProt ID | ECP_HUMAN | |
---|---|---|
UniProt AC | P12724 | |
Protein Name | Eosinophil cationic protein | |
Gene Name | RNASE3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 160 | |
Subcellular Localization | Secreted. Located in the matrix of eosinophil large specific granule, which are released following activation by an immune stimulus. | |
Protein Description | Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. Promotes E.coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.. | |
Protein Sequence | MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | Nitrated tyrosine | AMRAINNYRWRCKNQ EEHHHHHCEEEECCC | 13.68 | - | |
60 | Nitration | AMRAINNYRWRCKNQ EEHHHHHCEEEECCC | 13.68 | 18694936 | |
60 | Nitration | AMRAINNYRWRCKNQ EEHHHHHCEEEECCC | 13.68 | 18694936 | |
84 | N-linked_Glycosylation | NVVNVCGNQSIRCPH HHEHHCCCCCEECCC | 27.57 | UniProtKB CARBOHYD | |
92 | N-linked_Glycosylation | QSIRCPHNRTLNNCH CCEECCCCCCCCCCC | 24.63 | UniProtKB CARBOHYD | |
119 | N-linked_Glycosylation | LINPGAQNISNCTYA ECCCCCCCCCCCEEC | 38.84 | UniProtKB CARBOHYD | |
134 | Phosphorylation | DRPGRRFYVVACDNR CCCCCEEEEEEECCC | 7.69 | 22817900 | |
149 | Phosphorylation | DPRDSPRYPVVPVHL CCCCCCCCCCCCEEE | 12.08 | 24719451 | |
158 | Phosphorylation | VVPVHLDTTI----- CCCEEEECCC----- | 32.52 | 24719451 | |
159 | Phosphorylation | VPVHLDTTI------ CCEEEECCC------ | 25.10 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
POTEI_HUMAN | POTEI | physical | 28514442 | |
RINI_HUMAN | RNH1 | physical | 28514442 | |
GTPB2_HUMAN | GTPBP2 | physical | 28514442 | |
ACTBL_HUMAN | ACTBL2 | physical | 28514442 | |
ACTA_HUMAN | ACTA2 | physical | 28514442 | |
BLK_HUMAN | BLK | physical | 28514442 | |
ACTB_HUMAN | ACTB | physical | 28514442 | |
GNAZ_HUMAN | GNAZ | physical | 28514442 | |
GGPPS_HUMAN | GGPS1 | physical | 28514442 | |
UBAC1_HUMAN | UBAC1 | physical | 28514442 | |
EFR3B_HUMAN | EFR3B | physical | 28514442 | |
RN123_HUMAN | RNF123 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Nitration | |
Reference | PubMed |
"Post-translational tyrosine nitration of eosinophil granule toxinsmediated by eosinophil peroxidase."; Ulrich M., Petre A., Youhnovski N., Proemm F., Schirle M., Schumm M.,Pero R.S., Doyle A., Checkel J., Kita H., Thiyagarajan N.,Acharya K.R., Schmid-Grendelmeier P., Simon H.-U., Schwarz H.,Tsutsui M., Shimokawa H., Bellon G., Lee J.J., Przybylski M.,Doering G.; J. Biol. Chem. 283:28629-28640(2008). Cited for: NITRATION AT TYR-60. |