UniProt ID | E2F2_HUMAN | |
---|---|---|
UniProt AC | Q14209 | |
Protein Name | Transcription factor E2F2 | |
Gene Name | E2F2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 437 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F2 binds specifically to RB1 in a cell-cycle dependent manner.. | |
Protein Sequence | MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | QGPRALASAAGQTPK CCHHHHHHHCCCCCC | 21.36 | 22210691 | |
15 | Phosphorylation | LASAAGQTPKVVPAM HHHHCCCCCCCCCCC | 24.94 | 29414761 | |
88 | Ubiquitination | GRLPAKRKLDLEGIG CCCCCCCCCCCCCCC | 45.72 | - | |
104 | Phosphorylation | PVVPEFPTPKGKCIR CCCCCCCCCCCCEEE | 42.84 | 24719451 | |
117 | Phosphorylation | IRVDGLPSPKTPKSP EEECCCCCCCCCCCC | 44.03 | 30266825 | |
119 | Acetylation | VDGLPSPKTPKSPGE ECCCCCCCCCCCCCC | 80.12 | 60539 | |
119 | Ubiquitination | VDGLPSPKTPKSPGE ECCCCCCCCCCCCCC | 80.12 | 29967540 | |
120 | Phosphorylation | DGLPSPKTPKSPGEK CCCCCCCCCCCCCCC | 39.06 | - | |
122 | Acetylation | LPSPKTPKSPGEKTR CCCCCCCCCCCCCCC | 74.62 | 60543 | |
123 | Phosphorylation | PSPKTPKSPGEKTRY CCCCCCCCCCCCCCC | 39.06 | 24719451 | |
127 | Acetylation | TPKSPGEKTRYDTSL CCCCCCCCCCCCCHH | 44.19 | 60547 | |
130 | Phosphorylation | SPGEKTRYDTSLGLL CCCCCCCCCCHHHHH | 28.89 | 30576142 | |
132 | Phosphorylation | GEKTRYDTSLGLLTK CCCCCCCCHHHHHHH | 19.54 | 30576142 | |
133 | Phosphorylation | EKTRYDTSLGLLTKK CCCCCCCHHHHHHHH | 19.97 | 30576142 | |
139 | Ubiquitination | TSLGLLTKKFIYLLS CHHHHHHHHHHHHHH | 45.73 | 29967540 | |
187 | Ubiquitination | QLIRKKAKNNIQWVG HHHHHHHHHCCCEEC | 60.45 | - | |
206 | Ubiquitination | EDPTRPGKQQQLGQE CCCCCCCHHHHHHHH | 47.84 | 29967540 | |
234 | Phosphorylation | LIQSCSLSFKHLTED HHHHHCCCCCCCCCC | 18.89 | 24719451 | |
236 | Ubiquitination | QSCSLSFKHLTEDKA HHHCCCCCCCCCCCC | 34.04 | 29967540 | |
245 | Acetylation | LTEDKANKRLAYVTY CCCCCCCCEEEEEEH | 54.36 | 19829883 | |
262 | Ubiquitination | IRAVGNFKEQTVIAV HHHHCCCCCCEEEEE | 53.57 | - | |
270 | Ubiquitination | EQTVIAVKAPPQTRL CCEEEEEECCCCCEE | 46.27 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of E2F2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of E2F2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of E2F2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPIB_HUMAN | SPIB | physical | 12748276 | |
RYBP_HUMAN | RYBP | physical | 12411495 | |
KMT5A_HUMAN | SETD8 | physical | 12411495 | |
R144A_HUMAN | RNF144A | physical | 12411495 | |
FHL2_HUMAN | FHL2 | physical | 12411495 | |
RB_HUMAN | RB1 | physical | 12502741 | |
SP1_MOUSE | Sp1 | physical | 8657141 | |
KMT2A_HUMAN | KMT2A | physical | 16951254 | |
KMT2D_HUMAN | KMT2D | physical | 16951254 | |
ATAD2_HUMAN | ATAD2 | physical | 20855524 | |
RB_HUMAN | RB1 | physical | 17380128 | |
RB_HUMAN | RB1 | physical | 8246996 | |
GIT2_HUMAN | GIT2 | physical | 21988832 | |
GNB5_HUMAN | GNB5 | physical | 21988832 | |
E2F1_HUMAN | E2F1 | physical | 25241761 | |
UCHL5_HUMAN | UCHL5 | physical | 26396186 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...